Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00050 MBTPS1 Homo sapiens Yes Transcription Factors

HuProt v2.0
Block Row Column Clone
36 1 7 JHU00050
36 1 8 JHU00050
7 24 27 JHU00050
7 24 28 JHU00050
HuProt v3.0
Block Row Column Clone
3 5 20 JHU00050
3 6 20 JHU00050
18 45 18 JHU00050
18 46 18 JHU00050
HuProt v3.1
Block Row Column Clone
3 5 20 JHU00050
3 6 20 JHU00050
18 45 18 JHU00050
18 46 18 JHU00050

External Database ID
  • Unreviewed UniProt: H3BV53 (H3BV53_HUMAN)

Nucleotide (1659bp)

>JHU00050
ATGAAGCTTGTCAACATCTGGCTGCTTCTGCTCGTGGTTTTGCTCTGTGGGAAGAAACATCTGGGCGACAGACTGGAAAA
GAAATCTTTTGAAAAGGCCCCATGCCCTGGCTGTTCCCACCTGACTTTGAAGGTGGAATTCTCATCAACAGTTGTGGAAT
ATGAATATATTGTGGCTTTCAATGGATACTTTACAGCCAAAGCTAGAAATTCATTTATTTCAAGTGCCCTGAAGAGCAGT
GAAGTAGACAATTGGAGAATTATACCTCGAAACAATCCATCCAGTGACTACCCTAGTGATTTTGAGGTGATTCAGATAAA
AGAAAAACAGAAAGCGGGGCTGCTAACACTTGAAGATCATCCAAACATCAAACGGGTCACGCCCCAACGAAAAGTCTTTC
GTTCCCTCAAGTATGCTGAATCTGACCCCACAGTACCCTGCAATGAAACCCGGTGGAGCCAGAAGTGGCAATCATCACGT
CCCCTGCGAAGAGCCAGCCTCTCCCTGGGCTCTGGCTTCTGGCATGCTACGGGAAGGCATTCGAGCAGACGGCTGCTGAG
AGCCATCCCGCGCCAGGTTGCCCAGACACTGCAGGCAGATGTGCTCTGGCAGATGGGATATACAGGTGCTAATGTAAGAG
TTGCTGTTTTTGACACTGGGCTGAGCGAGAAGCATCCCCACTTCAAAAATGTGAAGGAGAGAACCAACTGGACCAACGAG
CGAACGCTGGACGATGGGTTGGGCCATGGCACATTCGTGGCAGGTGTGATAGCCAGCATGAGGGAGTGCCAAGGATTTGC
TCCAGATGCAGAACTTCACATTTTCAGGGTCTTTACCAATAATCAGGTATCTTACGCATCTTGGTTTTTGGACGCCTTCA
ACTATGCCATTTTAAAGAAGATCGACGTGTTAAACCTCAGCATCGGCGGCCCGGACTTCATGGATCATCCGTTTGTTGAC
AAGGTGTGGGAATTAACAGCTAACAATGTAATCATGGTTTCTGCTATTGGCAATGACGGACCTCTTTATGGCACTCTGAA
TAACCCTGCTGATCAAATGGATGTGATTGGAGTAGGCGGCATTGACTTTGAAGATAACATCGCCCGCTTTTCTTCAAGGG
GAATGACTACCTGGGAGCTACCAGGAGGCTACGGTCGCATGAAACCTGACATTGTCACCTATGGTGCTGGCGTGCGGGGT
TCTGGCGTGAAAGGGGGGTGCCGGGCCCTCTCAGGGACCAGTGTTGCTTCTCCAGTGGTTGCAGGTGCTGTCACCTTGTT
AGTGAGCACAGTCCAGAAGCGTGAGCTGGTGAATCCTGCCAGTATGAAGCAGGCCCTGATCGCGTCAGCCCGGAGGCTCC
CCGGGGTCAACATGTTTGAGCAAGGCCACGGCAAGCTCGATCTGCTCAGAGCCTATCAGATCCTCAACAGCTACAAGCCA
CAGGCAAGTTTGAGCCCCAGCTACATAGATCTGACTGAGTGTCCCTACATGTGGCCCTACTGCTCCCAGCCCATCTACTA
TGGAGGAATGCCGACAGTTGTTAATGTCACCATCCTCAACGGCATGGGAGTCACAGGAAGAATTGTAGATAAGCCTGACT
GGCAGCCCTATTTGCCACAGAACGGAGACAACATTGAAGTTGCCTTCTCCTACTCCTAG

Protein (552aa)

>JHU00050
MKLVNIWLLLLVVLLCGKKHLGDRLEKKSFEKAPCPGCSHLTLKVEFSSTVVEYEYIVAFNGYFTAKARNSFISSALKSS
EVDNWRIIPRNNPSSDYPSDFEVIQIKEKQKAGLLTLEDHPNIKRVTPQRKVFRSLKYAESDPTVPCNETRWSQKWQSSR
PLRRASLSLGSGFWHATGRHSSRRLLRAIPRQVAQTLQADVLWQMGYTGANVRVAVFDTGLSEKHPHFKNVKERTNWTNE
RTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYASWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVD
KVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVGGIDFEDNIARFSSRGMTTWELPGGYGRMKPDIVTYGAGVRG
SGVKGGCRALSGTSVASPVVAGAVTLLVSTVQKRELVNPASMKQALIASARRLPGVNMFEQGHGKLDLLRAYQILNSYKP
QASLSPSYIDLTECPYMWPYCSQPIYYGGMPTVVNVTILNGMGVTGRIVDKPDWQPYLPQNGDNIEVAFSYS