Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00005 AK1 Homo sapiens Yes Kinases; Metabolism

HuProt v2.0
Block Row Column Clone
2 1 1 JHU00005
2 1 2 JHU00005
HuProt v3.0
Block Row Column Clone
4 1 5 JHU00005
4 2 5 JHU00005
HuProt v3.1
Block Row Column Clone
4 1 5 JHU00005
4 2 5 JHU00005

External Database ID

Nucleotide (585bp)

>JHU00005
ATGGAAGAGAAGCTGAAGAAAACCAATATCATCTTTGTGGTGGGTGGGCCTGGCTCAGGGAAGGGCACCCAGTGTGAGAA
GATCGTGCAGAAGTATGGCTACACCCACCTCTCCACCGGGGACCTCCTGCGGTCCGAGGTCAGCTCAGGCTCGGCCAGGG
GCAAGAAGCTGTCGGAAATCATGGAGAAGGGGCAGCTGGTTCCACTGGAGACAGTGTTGGACATGCTCCGGGATGCCATG
GTGGCCAAAGTCAATACTTCCAAAGGCTTCCTGATTGATGGCTACCCGCGGGAGGTGCAGCAAGGAGAAGAGTTTGAGCG
ACGGATTGGACAGCCCACACTGCTGCTGTATGTGGACGCAGGCCCTGAGACCATGACCCAGCGGCTCTTGAAACGTGGAG
AGACCAGCGGGCGTGTGGACGACAATGAGGAGACCATCAAAAAGCGGCTGGAGACCTATTACAAGGCCACAGAACCCGTC
ATCGCCTTCTATGAGAAACGTGGCATTGTGCGCAAGGTCAACGCTGAGGGCTCCGTGGACAGTGTCTTCTCCCAGGTCTG
CACCCACCTGGACGCCCTAAAGTAG

Protein (194aa)

>JHU00005
MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAM
VAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPV
IAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK