Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00049 MBIP Homo sapiens Yes Kinases; Nuclear Proteins

HuProt v2.0
Block Row Column Clone
4 1 15 JHU00049
4 1 16 JHU00049
HuProt v3.0
Block Row Column Clone
1 3 20 JHU00049
1 4 20 JHU00049
HuProt v3.1
Block Row Column Clone
1 3 20 JHU00049
1 4 20 JHU00049

External Database ID

Nucleotide (1035bp)

>JHU00049
ATGGCTGCTGCCACGGAGCATAATCGCCCGAGCAGCGGTGACAGGAACCTGGAGCGAAGATGCAGCCCCAACCTCTCCCG
AGAGGTGCTCTACGAAATCTTTCGCTCCCTACACACCCTGGTTGGACAGCTTGACCTCAGAGATGATGTGGTGAAAATTA
CAATCGATTGGAACAAGCTCCAGAGCCTCTCGGCATTCCAGCCTGCATTGCTCTTTAGTGCACTTGAACAACACATTTTA
TATTTACAGCCTTTTTTAGCAAAACTTCAGTCTCCGATTAAAGAGGAGAATACAACTGCTGTTGAAGAGATAGGAAGAAC
AGAAATGGGGAACAAAAATGAAGTAAATGACAAATTTTCCATTGGCGACCTACAAGAGGAAGAAAAGCACAAAGAAAGTG
ATTTAAGAGATGTGAAAAAGACACAGATCCATTTTGATCCAGAAGTAGTTCAGATAAAGGCTGGAAAAGCAGAAATTGAC
AGACGAATATCTGCATTTATTGAAAGAAAGCAAGCTGAAATCAATGAAAACAACGTCAGGGAATTTTGCAATGTTATCGA
TTGTAATCAAGAAAATAGTTGTGCAAGAACTGATGCGATTTTTACCCCTTACCCCGGATTTAAAAGTCACGTAAAAGTTT
CTAGAGTTGTGTATACATACGGACCACAGACTAGACCTGAAGGAATTCCAGGGTCAGGTCATAAACCTAACAGCATGCTT
CGAGACTGTGGTAATCAGGCTGTAGAAGAACGACTACAAAATATTGAGGCCCACTTGCGGTTACAGACAGGTGGTCCAGT
GCCAAGAGACATTTATCAGAGAATTAAAAAACTTGAGGATAAAATCCTTGAATTGGAAGGCATCTCCCCTGAATATTTTC
AGTCTGTAAGCTTTTCTGGAAAAAGAAGAAAAGTTCAACCACCTCAACAGAACTATTCACTGGCTGAACTTGATGAGAAA
ATTAGTGCCCTCAAACAAGCCCTCCTCAGAAAATCAAGAGAAGCAGAATCCATGGCAACCCACCACCTCCCATAG

Protein (344aa)

>JHU00049
MAAATEHNRPSSGDRNLERRCSPNLSREVLYEIFRSLHTLVGQLDLRDDVVKITIDWNKLQSLSAFQPALLFSALEQHIL
YLQPFLAKLQSPIKEENTTAVEEIGRTEMGNKNEVNDKFSIGDLQEEEKHKESDLRDVKKTQIHFDPEVVQIKAGKAEID
RRISAFIERKQAEINENNVREFCNVIDCNQENSCARTDAIFTPYPGFKSHVKVSRVVYTYGPQTRPEGIPGSGHKPNSML
RDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVSFSGKRRKVQPPQQNYSLAELDEK
ISALKQALLRKSREAESMATHHLP