Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00048 MATK CTK;HYL Homo sapiens Yes Kinases; Signal Transduction

HuProt v2.0
Block Row Column Clone
12 1 13 JHU00048
12 1 14 JHU00048
HuProt v3.0
Block Row Column Clone
1 1 12 JHU00048
1 2 12 JHU00048
HuProt v3.1
Block Row Column Clone
1 1 12 JHU00048
1 2 12 JHU00048

External Database ID

Nucleotide (1524bp)

>JHU00048
ATGGCGGGGCGAGGCTCTCTGGTTTCCTGGCGGGCATTTCACGGCTGTGATTCTGCTGAGGAACTTCCCCGGGTGAGCCC
CCGCTTCCTCCGAGCCTGGCACCCCCCTCCCGTCTCAGCCAGGATGCCAACGAGGCGCTGGGCCCCGGGCACCCAGTGTA
TCACCAAATGCGAGCACACCCGCCCCAAGCCAGGGGAGCTGGCCTTCCGCAAGGGCGACGTGGTCACCATCCTGGAGGCC
TGCGAGAACAAGAGCTGGTACCGCGTCAAGCACCACACCAGTGGACAGGAGGGGCTGCTGGCAGCTGGGGCGCTGCGGGA
GCGGGAGGCCCTCTCCGCAGACCCCAAGCTCAGCCTCATGCCGTGGTTCCACGGGAAGATCTCGGGCCAGGAGGCTGTCC
AGCAGCTGCAGCCTCCCGAGGATGGGCTGTTCCTGGTGCGGGAGTCCGCGCGCCACCCCGGCGACTACGTCCTGTGCGTG
AGCTTTGGCCGCGACGTCATCCACTACCGCGTGCTGCACCGCGACGGCCACCTCACAATCGATGAGGCCGTGTTCTTCTG
CAACCTCATGGACATGGTGGAGCATTACAGCAAGGACAAGGGCGCTATCTGCACCAAGCTGGTGAGACCAAAGCGGAAAC
ACGGGACCAAGTCGGCCGAGGAGGAGCTGGCCAGGGCGGGCTGGTTACTGAACCTGCAGCATTTGACATTGGGAGCACAG
ATCGGAGAGGGAGAGTTTGGAGCTGTCCTGCAGGGTGAGTACCTGGGGCAAAAGGTGGCCGTGAAGAATATCAAGTGTGA
TGTGACAGCCCAGGCCTTCCTGGACGAGACGGCCGTCATGACGAAGATGCAACACGAGAACCTGGTGCGTCTCCTGGGCG
TGATCCTGCACCAGGGGCTGTACATTGTCATGGAGCACGTGAGCAAGGGCAACCTGGTGAACTTTCTGCGGACCCGGGGT
CGAGCCCTCGTGAACACCGCTCAGCTCCTGCAGTTTTCTCTGCACGTGGCCGAGGGCATGGAGTACCTGGAGAGCAAGAA
GCTTGTGCACCGCGACCTGGCCGCCCGCAACATCCTGGTCTCAGAGGACCTGGTGGCCAAGGTCAGCGACTTTGGCCTGG
CCAAAGCCGAGCGGAAGGGGCTAGACTCAAGCCGGCTGCCCGTCAAGTGGACGGCGCCCGAGGCTCTCAAACACGGGAAG
TTCACCAGCAAGTCGGATGTCTGGAGTTTTGGGGTGCTGCTCTGGGAGGTCTTCTCATATGGACGGGCTCCGTACCCTAA
AATGTCACTGAAAGAGGTGTCGGAGGCCGTGGAGAAGGGGTACCGCATGGAACCCCCCGAGGGCTGTCCAGGCCCCGTGC
ACGTCCTCATGAGCAGCTGCTGGGAGGCAGAGCCCGCCCGCCGGCCACCCTTCCGCAAACTGGCCGAGAAGCTGGCCCGG
GAGCTACGCAGTGCAGGTGCCCCAGCCTCCGTCTCAGGGCAGGACGCCGACGGCTCCACCTCGCCCCGAAGCCAGGAGCC
CTAG

Protein (507aa)

>JHU00048
MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHTRPKPGELAFRKGDVVTILEA
CENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCV
SFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQ
IGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQGLYIVMEHVSKGNLVNFLRTRG
RALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGK
FTSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLAR
ELRSAGAPASVSGQDADGSTSPRSQEP