Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00047 MAPKAPK3 Homo sapiens Yes Kinases; Nuclear Proteins; Signal Transduction; Transcription Factors

HuProt v2.0
Block Row Column Clone
4 1 5 JHU00047
4 1 6 JHU00047
HuProt v3.0
Block Row Column Clone
3 1 2 JHU00047
3 2 2 JHU00047
HuProt v3.1
Block Row Column Clone
3 1 2 JHU00047
3 2 2 JHU00047

External Database ID

Nucleotide (1149bp)

>JHU00047
ATGGATGGTGAAACAGCAGAGGAGCAGGGGGGCCCTGTGCCCCCGCCAGTTGCACCCGGCGGACCCGGCTTGGGCGGTGC
TCCGGGGGGGCGGCGGGAGCCCAAGAAGTACGCAGTGACCGACGACTACCAGTTGTCCAAGCAGGTGCTGGGCCTGGGTG
TGAACGGCAAAGTGCTGGAGTGCTTCCATCGGCGCACTGGACAGAAGTGTGCCCTGAAGCTCCTGTATGACAGCCCCAAG
GCCCGGCAGGAGGTAGACCATCACTGGCAGGCTTCTGGCGGCCCCCATATTGTCTGCATCCTGGATGTGTATGAGAACAT
GCACCATGGCAAGCGCTGTCTCCTCATCATCATGGAATGCATGGAAGGTGGTGAGTTGTTCAGCAGGATTCAGGAGCGTG
GCGACCAGGCTTTCACTGAGAGAGAAGCTGCAGAGATAATGCGGGATATTGGCACTGCCATCCAGTTTCTGCACAGCCAT
AACATTGCCCACCGAGATGTCAAGCCTGAAAACCTACTCTACACATCTAAGGAGAAAGACGCAGTGCTTAAGCTCACCGA
TTTTGGCTTTGCTAAGGAGACCACCCAAAATGCCCTGCAGACACCCTGCTATACTCCCTATTATGTGGCCCCTGAGGTCC
TGGGTCCAGAGAAGTATGACAAGTCATGTGACATGTGGTCCCTGGGTGTCATCATGTACATCCTCCTTTGTGGCTTCCCA
CCCTTCTACTCCAACACGGGCCAGGCCATCTCCCCGGGGATGAAGAGGAGGATTCGCCTGGGCCAGTACGGCTTCCCCAA
TCCTGAGTGGTCAGAAGTCTCTGAGGATGCCAAGCAGCTGATCCGCCTCCTGTTGAAGACAGACCCCACAGAGAGGCTGA
CCATCACTCAGTTCATGAACCACCCCTGGATCAACCAATCGATGGTAGTGCCACAGACCCCACTCCACACGGCCCGAGTG
CTGCAGGAGGACAAAGACCACTGGGACGAAGTCAAGGAGGAGATGACCAGTGCCTTGGCCACTATGCGGGTAGACTACGA
CCAGGTGAAGATCAAGGACCTGAAGACCTCTAACAACCGGCTCCTCAACAAGAGGAGAAAAAAGCAGGCAGGCAGCTCCT
CTGCCTCACAGGGCTGCAACAACCAGTAG

Protein (382aa)

>JHU00047
MDGETAEEQGGPVPPPVAPGGPGLGGAPGGRREPKKYAVTDDYQLSKQVLGLGVNGKVLECFHRRTGQKCALKLLYDSPK
ARQEVDHHWQASGGPHIVCILDVYENMHHGKRCLLIIMECMEGGELFSRIQERGDQAFTEREAAEIMRDIGTAIQFLHSH
NIAHRDVKPENLLYTSKEKDAVLKLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGFP
PFYSNTGQAISPGMKRRIRLGQYGFPNPEWSEVSEDAKQLIRLLLKTDPTERLTITQFMNHPWINQSMVVPQTPLHTARV
LQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSASQGCNNQ