Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU04634 EYA2 EAB1 Homo sapiens Yes Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
4 7 11 JHU04634
4 7 12 JHU04634
27 26 5 JHU04634
27 26 6 JHU04634
35 26 5 JHU04634
35 26 6 JHU04634
25 26 5 JHU04634
25 26 6 JHU04634
33 26 5 JHU04634
33 26 6 JHU04634
HuProt v3.0
Block Row Column Clone
6 15 20 JHU04634
6 16 20 JHU04634
23 1 24 JHU04634
23 2 24 JHU04634
23 3 6 JHU04634
23 4 6 JHU04634
23 1 25 JHU04634
23 2 25 JHU04634
23 3 1 JHU04634
23 4 1 JHU04634
HuProt v3.1
Block Row Column Clone
6 15 20 JHU04634
6 16 20 JHU04634
23 1 24 JHU04634
23 2 24 JHU04634
23 3 6 JHU04634
23 4 6 JHU04634
23 1 25 JHU04634
23 2 25 JHU04634
23 3 1 JHU04634
23 4 1 JHU04634

External Database ID

Nucleotide (1545bp)

>JHU04634
ATGGTAGAACTAGTGATCTCACCCAGCCTCACTGTAAACAGCGATTGTCTGGATAAACTGAAGTTTAACCGTGCTGACGC
TGCTGTGTGGACTCTGAGTGACAGACAAGGCATCACCAAATCGGCCCCCCTGAGAGTGTCCCAGCTCTTCTCCAGATCTT
GCCCACGTGTCCTCCCCCGCCAGCCTTCCACAGCCATGGCAGCCTACGGCCAGACGCAGTACAGTGCGGGGATCCAGCAG
GCTACCCCCTATACAGCTTACCCACCTCCAGCACAAGCCTATGGAATCCCTTCCTTCAGCACCTCACCCACTGGACAGAG
CCCATACACCTACCAGATGCACGGCACAACAGGGTTCTATCAAGGAGGAAATGGACTGGGCAACGCAGCCGGTTTCGGGA
GTGTGCACCAGGACTATCCTTCCTACCCCGGCTTCCCCCAGAGCCAGTACCCCCAGTATTACGGCTCATCCTACAACCCT
CCCTACGTCCCGGCCAGCAGCATCTGCCCTTCGCCCCTCTCCACGTCCACCTACGTCCTCCAGGAGGCATCTCACAACGT
CCCCAACCAGAGTTCCGAGTCACTTGCTGGTGAATACAACACACACAATGGACCTTCCACACCAGCGAAAGAGGGAGACA
CAGATAGGCCGCACCGGGCCTCCGACGGGAAGCTCCGAGGCCGGTCTAAGAGGAGCAGTGACCCGTCCCCGGCAGGGGAC
AATGAGATTGAGCGTGTGTTCGTGTGGGACTTGGATGAGACAATAATTATTTTTCACTCCTTACTCACGGGGACATTTGC
ATCCAGATACGGGAAGGACACCACGACGTCCGTGCGCATTGGCCTTATGATGGAAGAGATGATCTTCAACCTTGCAGATA
CACATCTGTTCTTCAATGACCTGGAGGATTGTGACCAGATCCACGTTGATGACGTCTCATCAGATGACAATGGCCAAGAT
TTAAGCACATACAACTTCTCCGCTGACGGCTTCCACAGTTCGGCCCCAGCAGCCAACCTGTGCCTGGGCTCTGGCGTGCA
CGGCGGCGTGGACTGGATGAGGAAGCTGGCCTTCCGCTACCGGCGGGTGAAGGAGATGTACAATACCTACAAGAACAACG
TTGGTGGGTTGATAGGCACTCCCAAAAGGGAGACCTGGCTACAGCTCCGAGCTGAGCTGGAAGCTCTCACAGACCTCTGG
CTGACCCACTCCCTGAAGGCACTAAACCTCATCAACTCCCGGCCCAACTGTGTCAATGTGCTGGTCACCACCACTCAACT
AATTCCTGCCCTGGCCAAAGTCCTGCTATATGGCCTGGGGTCTGTGTTTCCTATTGAGAACATCTACAGTGCAACCAAGA
CAGGGAAGGAGAGCTGCTTCGAGAGGATAATGCAGAGATTCGGCAGAAAAGCTGTCTACGTGGTGATCGGTGATGGTGTG
GAAGAGGAGCAAGGAGCGAAAAAGCACAACATGCCTTTCTGGCGGATATCCTGCCACGCAGACCTGGAGGCACTGAGGCA
CGCCCTGGAGCTGGAGTATTTATAG

Protein (514aa)

>JHU04634
MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQ
ATPYTAYPPPAQAYGIPSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNP
PYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGD
NEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQD
LSTYNFSADGFHSSAPAANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEALTDLW
LTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGV
EEEQGAKKHNMPFWRISCHADLEALRHALELEYL