Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00044 PI4KAP2 Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
42 1 7 JHU00044
42 1 8 JHU00044
31 24 27 JHU00044
31 24 28 JHU00044
HuProt v3.0
Block Row Column Clone
3 5 23 JHU00044
3 6 23 JHU00044
18 47 30 JHU00044
18 48 30 JHU00044
HuProt v3.1
Block Row Column Clone
3 5 23 JHU00044
3 6 23 JHU00044
18 47 30 JHU00044
18 48 30 JHU00044

External Database ID
  • Reviewed UniProt: A4QPH2-3 (PI4P2_HUMAN)

Nucleotide (1734bp)

>JHU00044
ATGCACCCCCAGGAAGGCCACGCGCTCAGGAGGCCCCCCCCCCGCTGGCTGCTGCTCACATGGTGTCTGGGCCCTTGGCA
CTCCGTTCATGCGGGAGATGACAGGGGCTGGCACATGACAGTGGAGCAGAAATTTGGCCTGTTTTCTGCTGAGATAAAGG
AAGCAGACCCCCTGGCTGCCTCGGAAGCAAGTCAACCCAAACCCTGTCCCCCCGAAGTGACCCCCCACTACATCTGGATC
GACTTCCTGGTGCAGCGGTTTGAGATCGCCAAGTACTGCAGCTCTGACCAAGTGGAGATCTTCTCCAGCCTGCTGCAGCG
CTCCATGTCCCTGAACATCGGCAGGGCCAAGGGGAGCATGAACCGGCACGTGGCGGCCATCGGGCCCCGCTTCAAGCTGC
TGACCCTGGGGCTGTCCCTCCTGCATGCCGATGTGGTTCCAAATGCAACCATCCGCAATGTGCTTCGCGAGAAGATCTAC
TCCACTGCCTTTGACTACTTCAGCTGTCCCCCAAAGTTTCCTACTCAAGGAGAGAAGCGGCTGCGTGAAGACATAAGCAT
CATGATTAAATTTTGGACCGCCATGTTCTCAGATAAGAAGTACCTGACCGCCAGCCAGCTTGTTCCCCCAGCTGACATCG
GCGACCTCCTGGAGCAGTTAGTAGAGGAGAACACAGGCTCCTTGTCGGGCCCAGCGAAGGACTTTTACCAGCGGGAGTTT
GATTTCTTTAACAAGATCACCAACGTGTCGGCTATCATCAAGCCCTACCCTAAAGGCGACGAGAGAAAGAAGGCTTGTCT
GTCGGCCCTGTCTGAAGTGACGGTGCAGCCAGGCTGCTCCCTGCCCAGCAACCCCGAAGCCATTGTGCTGGACGTCGACT
ACAAGTCTGGGACCCCGATGCAGAGTGCTGCAAAAGCCCCATATCTGGCCAAGTTCAAGGTGAAGCGATGTGGAGTTAGT
GAACTTGAAAAAGAAGGTCTGCGGTGCCGCTCAGACTCTGAGGATGAGTGCAGCACGCAGGAGGCCGACGGCCAGAAGAT
CTCCTGGCAGGCAGCCATCTTCAAACTGGGAGACGACTGCCGGCAGGACATGCTGGCCCTGCAGATCATCGACCTCTTCA
AGAACATCTTCCAGCTGGTCGGCCTGGACCTCTTTGTTTTTCCCTACCGCGTGGTGGCCACTGCCCCTGGGTGCGGGGTG
ATCGAGTGCATCCCCGACTGCACCTCCCGGGACCAGCTGGGCCGCCAGACAGACTTCGGCATGTACGACTACTTCACACG
CCAGTACGGGGATGAGTCCACTCTGGCCTTCCAGCAGGCCCGCTACAACTTCATCCGAAGCATGGCCGCCTACAGCCTCC
TGCTGTTCCTGCTGCAGATCAAGGACAGACACAACGGCAACATTATGCTGGACAAGAAGGGCCATATCATCCACATTGAC
TTTGGCTTCATGTTTGAAAGCTCGCCGGGCGGCAATCTCGGCTGGGAACCCGACATCAAGCTGACGGATGAGATGGTGAT
GATCATGGGGGGCAAGATGGAGGCCACACCCTTCAAGTGGTTCATGGAGATGTGTGTCCGAGGCTACCTGGCTGTGCGGC
ACAGGTTTAGCCCCAACATGACTGAGCGCGAGGCTGCAAATTTCATCATGAAGGTCATCCAGAGCTGCTTCCTCAGCAAC
AGGAGCCGGACCTACAACATGATCCAGTACTATCAGAATGACATCCCCTACTAG

Protein (577aa)

>JHU00044
MHPQEGHALRRPPPRWLLLTWCLGPWHSVHAGDDRGWHMTVEQKFGLFSAEIKEADPLAASEASQPKPCPPEVTPHYIWI
DFLVQRFEIAKYCSSDQVEIFSSLLQRSMSLNIGRAKGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIY
STAFDYFSCPPKFPTQGEKRLREDISIMIKFWTAMFSDKKYLTASQLVPPADIGDLLEQLVEENTGSLSGPAKDFYQREF
DFFNKITNVSAIIKPYPKGDERKKACLSALSEVTVQPGCSLPSNPEAIVLDVDYKSGTPMQSAAKAPYLAKFKVKRCGVS
ELEKEGLRCRSDSEDECSTQEADGQKISWQAAIFKLGDDCRQDMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGV
IECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHID
FGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRHRFSPNMTEREAANFIMKVIQSCFLSN
RSRTYNMIQYYQNDIPY