Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00043 LCP2 Homo sapiens Yes Kinases; Signal Transduction

HuProt v2.0
Block Row Column Clone
5 24 27 JHU00043
5 24 28 JHU00043
HuProt v3.0
Block Row Column Clone
18 45 21 JHU00043
18 46 21 JHU00043
HuProt v3.1
Block Row Column Clone
18 45 21 JHU00043
18 46 21 JHU00043

External Database ID

Nucleotide (1602bp)

>JHU00043
ATGGCACTGAGGAATGTGCCCTTTCGCTCAGAGGTCCTGGGCTGGGACCCCGACAGCCTTGCTGACTATTTCAAGAAGCT
CAACTATAAGGACTGTGAGAAGGCAGTGAAGAAGTACCACATCGATGGGGCTCGCTTCTTGAACCTGACAGAAAATGACA
TCCAGAAGTTCCCCAAGCTCCGGGTGCCGATTCTCAGTAAGTTAAGTCAGGAAATCAACAAGAACGAAGAGAGGAGGAGC
ATCTTCACACGCAAACCCCAAGTCCCGCGGTTTCCTGAAGAGACAGAAAGCCACGAAGAGGACAATGGGGGCTGGTCGTC
CTTTGAAGAAGACGATTATGAAAGTCCCAATGATGACCAGGATGGGGAGGATGATGGAGACTATGAGTCCCCCAATGAGG
AGGAAGAGGCACCCGTGGAAGATGACGCGGATTATGAGCCGCCACCCTCCAATGACGAGGAAGCTCTGCAGAACTCCATC
CTGCCTGCCAAGCCTTTCCCCAACTCCAACTCCATGTACATCGACCGGCCCCCCTCTGGGAAAACCCCCCAGCAGCCTCC
TGTGCCCCCCCAGAGACCGATGGCCGCCCTCCCGCCCCCACCAGCCGGCCGGAATCACTCGCCACTGCCCCCACCCCAGA
CCAACCACGAAGAACCCAGCAGAAGCAGAAACCACAAAACGGCAAAGCTCCCTGCTCCTTCAATAGACAGAAGCACGAAA
CCTCCCCTAGATCGTTCATTAGCTCCGTTTGATAGAGAACCCTTCACACTAGGAAAGAAACCACCATTTTCTGACAAGCC
CTCGATTCCAGCGGGAAGGTCACTCGGGGAGCATTTACCCAAGATTCAAAAGCCTCCTTTACCACCGACCACGGAAAGAC
ATGAAAGGAGCAGCCCCCTGCCAGGGAAGAAGCCACCTGTGCCAAAGCATGGATGGGGACCAGACAGAAGAGAGAATGAT
GAAGATGATGTGCATCAGAGACCTTTGCCCCAGCCAGCACTACTTCCTATGAGCTCCAACACTTTCCCTTCAAGATCTAC
TAAGCCAAGTCCCATGAACCCTCTCCCATCCTCTCACATGCCTGGAGCATTCTCAGAAAGTAACAGCAGTTTTCCACAGA
GTGCCTCCCTGCCACCATACTTCTCTCAAGGCCCTAGCAACAGACCACCTATCAGAGCCGAAGGCAGAAACTTCCCCTTG
CCACTTCCAAACAAACCTCGGCCCCCATCCCCCGCGGAGGAAGAGAATTCATTAAATGAAGAGTGGTACGTTTCTTATAT
TACCCGACCAGAGGCAGAAGCTGCTCTTAGAAAGATAAACCAGGATGGCACATTTCTGGTCAGAGACAGCTCTAAAAAAA
CAACAACCAATCCATATGTCCTCATGGTGTTGTACAAAGATAAAGTTTACAACATCCAGATCCGTTATCAGAAGGAAAGT
CAAGTTTACTTGTTGGGAACTGGACTCCGAGGGAAAGAGGACTTTCTGTCTGTGTCAGATATTATTGACTACTTCAGGAA
AATGCCACTTCTGCTCATTGATGGGAAAAACCGAGGTTCCAGATACCAGTGCACATTAACGCATGCTGCAGGGTACCCAT
AG

Protein (533aa)

>JHU00043
MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRS
IFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSI
LPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTK
PPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLPKIQKPPLPPTTERHERSSPLPGKKPPVPKHGWGPDRREND
EDDVHQRPLPQPALLPMSSNTFPSRSTKPSPMNPLPSSHMPGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPL
PLPNKPRPPSPAEEENSLNEEWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKES
QVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP