Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00041 ITGB1BP1 ICAP1 Homo sapiens Yes Kinases; Membrane Proteins; Nuclear Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
26 1 7 JHU00041
26 1 8 JHU00041
HuProt v3.0
Block Row Column Clone
3 5 15 JHU00041
3 6 15 JHU00041
HuProt v3.1
Block Row Column Clone
3 5 15 JHU00041
3 6 15 JHU00041

External Database ID

Nucleotide (603bp)

>JHU00041
ATGTTTCGCAAGGGCAAAAAACGACACAGTAGTAGCAGTTCCCAAAGTAGCGAAATCAGTACTAAGAGCAAGTCTGTGGA
TTCTAGCCTTGGGGGTCTTTCACGATCCAGCACTGTGGCCAGCCTCGACACAGATTCCACCAAAAGCTCAGGACAAAGCA
ACAATAATTCAGATACCTGTGCAGAATTTCGAATAAAATATGTTGGTGCCATTGAGAAACTGAAACTCTCCGAGGGAAAA
GGCCTTGAAGGGCCATTAGACCTGATAAATTATATAGACGTTGCCCAGCAAGATGGAAAGTTGCCTTTTGTTCCTCCGGA
GGAAGAATTTATTATGGGAGTTTCCAAGTATGGCATAAAAGTATCAACATCAGATCAATATGATGTTTTGCACAGGCATG
CTCTCTACTTAATAATCCGGATGGTGTGTTACGATGACGGTCTGGGGGTGGGAAAAAGCTTACTGGCTCTGAAGACCACA
GATGCAAGCAATGAGGAATACAGCCTGTGGGTTTATCAGTGCAACAGCCTGGAACAAGCACAAGCCATTTGCAAGGTTTT
ATCCACCGCTTTTGACTCTGTATTAACATCTGAGAAACCCTAG

Protein (200aa)

>JHU00041
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGK
GLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGVGKSLLALKTT
DASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP