Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00039 IKBKB IKKB Homo sapiens Yes Cell Death; Kinases; Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
44 1 5 JHU00039
44 1 6 JHU00039
15 24 27 JHU00039
15 24 28 JHU00039
HuProt v3.0
Block Row Column Clone
3 3 12 JHU00039
3 4 12 JHU00039
18 45 28 JHU00039
18 46 28 JHU00039
HuProt v3.1
Block Row Column Clone
3 3 12 JHU00039
3 4 12 JHU00039
18 45 28 JHU00039
18 46 28 JHU00039

External Database ID

Nucleotide (771bp)

>JHU00039
ATGAGCTGGTCACCTTCCCTGACAACGCAGACATGTGGGGCCTGGGAAATGAAAGAGCGCCTTGGGACAGGGGGATTTGG
AAATGTCATCCGATGGCACAATCAGGAAACAGGTGAGCAGATTGCCATCAAGCAGTGCCGGCAGGAGCTCAGCCCCCGGA
ACCGAGAGCGGTGGTGCCTGGAGATCCAGATCATGAGAAGGCTGACCCACCCCAATGTGGTGGCTGCCCGAGATGTCCCT
GAGGGGATGCAGAACTTGGCGCCCAATGACCTGCCCCTGCTGGCCATGGAGTACTGCCAAGGAGGAGATCTCCGGAAGTA
CCTGAACCAGTTTGAGAACTGCTGTGGTCTGCGGGAAGGTGCCATCCTCACCTTGCTGAGTGACATTGCCTCTGCGCTTA
GATACCTTCATGAAAACAGAATCATCCATCGGGATCTAAAGCCAGAAAACATCGTCCTGCAGCAAGGAGAACAGAGGTTA
ATACACAAAATTATTGACCTAGGATATGCCAAGGAGCTGGATCAGGGCAGTCTTTGCACATCATTCGTGGGGACCCTGCA
GTACCTGGCCCCAGAGCTACTGGAGCAGCAGAAGTACACAGTGACCGTCGACTACTGGAGCTTCGGCACCCTGGCCTTTG
AGTGCATCACGGGCTTCCGGCCCTTCCTCCCCAACTGGCAGCCCGTGCAGTGCGTAAGAATGTGGCCGGGTACAGTGGCT
CACTCCTGTAATCCCAGCACTTTGGGAGGCCGAGGCAGGTGGATCAGTTAG

Protein (256aa)

>JHU00039
MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVP
EGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRL
IHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVA
HSCNPSTLGGRGRWIS