Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00380 TRIML1_frag RNF209 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
23 1 9 JHU00380
23 1 10 JHU00380
HuProt v3.0
Block Row Column Clone
2 1 18 JHU00380
2 2 18 JHU00380
HuProt v3.1
Block Row Column Clone
2 1 18 JHU00380
2 2 18 JHU00380

Nucleotide (579bp)

>JHU00380
ATGAAGGAGATGCTAAGAAAATTCAGCACGGAGATAACGCTGGACCCAGCCACAGCTAATGCCTATCTCGTGTTGTCGGA
GGATCTGAAGAGTGTGAAATATGGGGGAAGCAGACAGCAGCTACCCGACAACCCGGAAAGATTTGACCAGTCTGCGACTG
TGCTGGGTACTCAGATCTTCACCAGTGGGAGACACTACTGGGAGGTGGAGGTGGGAAACAAGACCGAGTGGGAAGTGGGC
ATCTGCAAGGACTCTGTGAGCAGAAAGGGGAATCTCCCCAAGCCACCTGGGGACCTGTTCTCACTAATAGGTTTAAAAAT
CGGAGATGATTACAGCCTCTGGGTCTCGTCACCTTTGAAAGGTCAGCACGTCAGAGAGCCTGTGTGTAAGGTTGGTGTCT
TCCTGGACTATGAATCTGGACATATAGCATTCTACAACGGGACGGATGAATCCCTCATCTACAGCTTCCCGCAGGCTTCT
TTCCAAGAGGCCCTCAGGCCTATCTTTTCCCCCTGCCTCCCAAATGAGGGGACAAACACAGACCCTCTCACCATCTGCTC
ACTGAACAGCCACGTCTAG

Protein (192aa)

>JHU00380
MKEMLRKFSTEITLDPATANAYLVLSEDLKSVKYGGSRQQLPDNPERFDQSATVLGTQIFTSGRHYWEVEVGNKTEWEVG
ICKDSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGVFLDYESGHIAFYNGTDESLIYSFPQAS
FQEALRPIFSPCLPNEGTNTDPLTICSLNSHV