Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00038 HSPB8 CRYAC;E2IG1;HSP22 Homo sapiens Yes Kinases; Nuclear Proteins

HuProt v2.0
Block Row Column Clone
18 1 9 JHU00038
18 1 10 JHU00038
HuProt v3.0
Block Row Column Clone
2 1 3 JHU00038
2 2 3 JHU00038
HuProt v3.1
Block Row Column Clone
2 1 3 JHU00038
2 2 3 JHU00038

External Database ID

Nucleotide (591bp)

>JHU00038
ATGGCTGACGGTCAGATGCCCTTCTCCTGCCACTACCCAAGCCGCCTGCGCCGAGACCCCTTCCGGGACTCTCCCCTCTC
CTCTCGCCTGCTGGATGATGGCTTTGGCATGGACCCCTTCCCAGACGACTTGACAGCCTCTTGGCCCGACTGGGCTCTGC
CTCGTCTCTCCTCCGCCTGGCCAGGCACCCTAAGGTCGGGCATGGTGCCCCGGGGCCCCACTGCCACCGCCAGGTTTGGG
GTGCCTGCCGAGGGCAGGACCCCCCCACCCTTCCCTGGGGAGCCCTGGAAAGTGTGTGTGAATGTGCACAGCTTCAAGCC
AGAGGAGTTGATGGTGAAGACCAAAGATGGATACGTGGAGGTGTCTGGCAAACATGAAGAGAAACAGCAAGAAGGTGGCA
TTGTTTCTAAGAACTTCACAAAGAAAATCCAGCTTCCTGCAGAGGTGGATCCTGTGACAGTATTTGCCTCACTTTCCCCA
GAGGGTCTGCTGATCATCGAAGCTCCCCAGGTCCCTCCTTACTCAACATTTGGAGAGAGCAGTTTCAACAACGAGCTTCC
CCAGGACAGCCAGGAAGTCACCTGTACCTAG

Protein (196aa)

>JHU00038
MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFG
VPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSP
EGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT