Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00371 TAGLN2 KIAA0120 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
39 1 7 JHU00371
39 1 8 JHU00371
HuProt v3.0
Block Row Column Clone
3 5 18 JHU00371
3 6 18 JHU00371
HuProt v3.1
Block Row Column Clone
3 5 18 JHU00371
3 6 18 JHU00371

External Database ID

Nucleotide (600bp)

>JHU00371
ATGGCCAACAGGGGACCTGCATATGGCCTGAGCCGGGAGGTGCAGCAGAAGATTGAGAAACAATATGATGCAGATCTGGA
GCAGATCCTGATCCAGTGGATCACCACCCAGTGCCGAAAGGATGTGGGCCGGCCCCAGCCTGGACGCGAGAACTTCCAGA
ACTGGCTCAAGGATGGCACGGTGCTATGTGAGCTCATTAATGCACAGTACCCCGAGGGGCAGGCCCCAGTAAAGAAGATC
CAGGCCTCCACCATGGCCTTCAAGCAGATGGAGCAGATCTCTCAGTTCCTGCAAGCAGCTGAGCGCTATGGCATTAACAC
CACTGACATCTTCCAAACTGTGGACCTCTGGGAAGGAAAGAACATGGCCTGTGTGCAGCGGACGCTGATGAATCTGGGTG
GGCTGGCAGTAGCCCGGGATGATGGGCTCTTCTCTGGGGATCCCAACTGGTTCCCTAAGAAATCCAAGGAGAATCCTCGG
AACTTCTCGGATAACCAGCTGCAAGAGGGCAAGAACGTGATCGGGTTACAGATGGGCACCAACCGCGGGGCGTCTCAGGC
AGGCATGACTGGCTACGGGATGCCACGCCAGATCCTCTAG

Protein (199aa)

>JHU00371
MANRGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINAQYPEGQAPVKKI
QASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLMNLGGLAVARDDGLFSGDPNWFPKKSKENPR
NFSDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPRQIL