Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00366 SERBP1 PAIRBP1 Homo sapiens Yes Nuclear Proteins

HuProt v2.0
Block Row Column Clone
23 1 7 JHU00366
23 1 8 JHU00366
HuProt v3.0
Block Row Column Clone
3 5 10 JHU00366
3 6 10 JHU00366
HuProt v3.1
Block Row Column Clone
3 5 10 JHU00366
3 6 10 JHU00366

External Database ID

Nucleotide (1209bp)

>JHU00366
ATGCCTGGGCACTTACAGGAAGGCTTCGGCTGCGTGGTCACCAACCGATTCGACCAGTTATTTGACGACGAATCGGACCC
CTTCGAGGTGCTGAAGGCAGCAGAGAACAAGAAAAAAGAAGCCGGCGGGGGCGGCGTTGGGGGCCCTGGGGCCAAGAGCG
CAGCTCAGGCCGCGGCCCAGACCAACTCCAACGCGGCAGGCAAACAGCTGCGCAAGGAGTCCCAGAAAGACCGCAAGAAC
CCGCTGCCCCCCAGCGTTGGCGTGGTTGACAAGAAAGAGGAGACGCAGCCGCCCGTGGCGCTTAAGAAAGAAGGAATAAG
ACGAGTTGGAAGAAGACCTGATCAACAACTTCAGGGTGAAGGGAAAATAATTGATAGAAGACCAGAAAGGCGACCACCTC
GTGAACGAAGATTCGAAAAGCCACTTGAAGAAAAGGGTGAAGGAGGCGAATTTTCAGTTGATAGACCGATTATTGACCGA
CCTATTCGAGGTCGTGGTGGTCTTGGAAGAGGTCGAGGGGGCCGTGGACGTGGAATGGGCCGAGGAGATGGATTTGATTC
TCGTGGCAAACGTGAATTTGATAGGCATAGTGGAAGTGATAGATCTGGCCTGAAGCACGAGGACAAACGTGGAGGTAGCG
GATCTCACAACTGGGGAACTGTCAAAGACGAATTAACAGAGTCCCCCAAATACATTCAGAAACAAATATCTTATAATTAC
AGTGACTTGGATCAATCAAATGTGACTGAGGAAACACCTGAAGGTGAAGAACATCATCCAGTGGCAGACACTGAAAATAA
GGAGAATGAAGTTGAAGAGGTAAAAGAGGAGGGTCCAAAAGAGATGACTTTGGATGAGTGGAAGGCTATTCAAAATAAGG
ACCGGGCAAAAGTAGAATTTAATATCCGAAAACCAAATGAAGGTGCTGATGGGCAGTGGAAGAAGGGATTTGTTCTTCAT
AAATCAAAGAGTGAAGAGGCTCATGCTGAAGATTCGGTTATGGACCATCATTTCCGGAAGCCAGCAAATGATATAACGTC
TCAGCTGGAGATCAATTTTGGAGACCTTGGCCGCCCAGGACGTGGCGGCAGGGGAGGACGAGGTGGATGTGGGCGTGGTG
GGCGCCCAAACCGTGGCAGCAGGACCGACAAGTCAAGTGCTTCTGCTCCTGATGTGGATGACCCAGAGGCATTCCCAGCT
CTGGCTTAG

Protein (402aa)

>JHU00366
MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQLRKESQKDRKN
PLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEKPLEEKGEGGEFSVDRPIIDR
PIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNY
SDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWKKGFVLH
KSKSEEAHAEDSVMDHHFRKPANDITSQLEINFGDLGRPGRGGRGGRGGCGRGGRPNRGSRTDKSSASAPDVDDPEAFPA
LA