Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00036 GUK1 GMK Homo sapiens Yes Kinases; Metabolism

HuProt v2.0
Block Row Column Clone
44 1 9 JHU00036
44 1 10 JHU00036
HuProt v3.0
Block Row Column Clone
2 3 12 JHU00036
2 4 12 JHU00036
HuProt v3.1
Block Row Column Clone
2 3 12 JHU00036
2 4 12 JHU00036

External Database ID

Nucleotide (594bp)

>JHU00036
ATGTCGGGCCCCAGGCCTGTGGTGCTGAGCGGGCCTTCGGGAGCTGGGAAGAGCACCCTGCTGAAGAGGCTGCTCCAGGA
GCACAGCGGCATCTTTGGCTTCAGCGTGTCCCATACCACGAGGAACCCGAGGCCCGGCGAGGAGAACGGCAAAGATTACT
ACTTTGTAACCAGGGAGGTGATGCAGCGTGACATAGCAGCCGGCGACTTCATCGAGCATGCCGAGTTCTCGGGGAACCTG
TATGGCACGAGCAAGGTGGCGGTGCAGGCCGTGCAGGCCATGAACCGCATCTGTGTGCTGGACGTGGACCTGCAGGGTGT
GCGGAACATCAAGGCCACCGATCTGCGGCCCATCTACATCTCTGTGCAGCCGCCTTCACTGCACGTGCTGGAGCAGCGGC
TGCGGCAGCGCAACACTGAAACCGAGGAGAGCCTGGTGAAGCGGCTGGCTGCTGCCCAGGCCGACATGGAGAGCAGCAAG
GAGCCCGGCCTGTTTGATGTGGTCATCATTAACGACAGCCTGGACCAGGCCTACGCAGAGCTGAAGGAGGCGCTCTCTGA
GGAAATCAAGAAAGCTCAAAGGACCGGCGCCTAG

Protein (197aa)

>JHU00036
MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNL
YGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSK
EPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA