Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00035 GTF2I BAP135;WBSCR6 Homo sapiens Yes Kinases; Nuclear Proteins; Signal Transduction; Transcription Factors

HuProt v2.0
Block Row Column Clone
26 1 1 JHU00035
26 1 2 JHU00035
HuProt v3.0
Block Row Column Clone
4 1 23 JHU00035
4 2 23 JHU00035
HuProt v3.1
Block Row Column Clone
4 1 23 JHU00035
4 2 23 JHU00035

External Database ID

Nucleotide (825bp)

>JHU00035
ATGGCCCAAGTTGCAATGTCCACCCTCCCCGTTGAAGATGAGGAGTCCTCGGAGAGCAGGATGGTGGTGACATTCCTCAT
GTCAGCTCTCGAGTCCATGTGTAAAGAACTGGCCAAGTCCAAAGCCGAAGTGGCCTGCATTGCAGTGTATGAAACAGACG
TGTTTGTCGTCGGAACTGAAAGAGGACGTGCTTTTGTCAATACCAGAAAGGATTTTCAAAAAGATTTTGTAAAATATTGT
GTTGAAGAAGAAGAAAAAGCTGCAGAGATGCATAAAATGAAATCTACAACCCAGGCAAATCGGATGAGTGTAGATGCTGT
AGAAATTGAAACACTCAGAAAAACAGTTGAGGACTATTTCTGCTTTTGCTATGGGAAAGCTTTAGGCAAATCCACAGTGG
TACCTGTACCATATGAGAAGATGCTGCGAGACCAGTCGGCTGTGGTAGTGCAGGGGCTTCCGGAAGGTGTTGCCTTTAAA
CACCCCGAGAACTATGATCTTGCAACCCTGAAATGGATTTTGGAGAACAAAGCAGGGATTTCATTCATCATTAAGAGACC
TTTTTTAGAGCCAAAGAAGCATGTAGGTGGTCGTGTGATGGTAACAGATGCTGACAGGTCAATACTATCTCCAGGTGGAA
GTTGTGGCCCCATCAAAGTGAAAACTGAACCCACAGAAGATTCTGGCATTTCCCTGGAAATGGCAGCTGTGACAGTAAAG
GAAGAATCAGAAGATCCTGATTATTATCAATATAACATTCAAGGAAGCCACCATTCTTCAGAGGGCAATGAAGGCACAGA
AATGGAAGTACCAGCAGAAGGTTAG

Protein (274aa)

>JHU00035
MAQVAMSTLPVEDEESSESRMVVTFLMSALESMCKELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYC
VEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFK
HPENYDLATLKWILENKAGISFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVK
EESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG