Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00347 PANK3 Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
15 1 9 JHU00347
15 1 10 JHU00347
HuProt v3.0
Block Row Column Clone
2 1 30 JHU00347
2 2 30 JHU00347
HuProt v3.1
Block Row Column Clone
2 1 30 JHU00347
2 2 30 JHU00347

External Database ID

Nucleotide (1113bp)

>JHU00347
ATGAAGATCAAAGATGCCAAGAAACCCTCTTTCCCATGGTTTGGCATGGACATTGGGGGAACTCTAGTAAAGCTCTCGTA
CTTTGAACCTATTGATATCACAGCAGAGGAAGAGCAAGAAGAAGTTGAGAGTTTAAAAAGTATTCGGAAATATTTGACTT
CTAACGTGGCATATGGATCCACCGGCATTCGGGATGTACACCTTGAACTGAAAGATTTAACACTTTTTGGCCGAAGAGGG
AACTTGCACTTTATCAGGTTTCCAACCCAGGACCTGCCTACTTTTATCCAAATGGGAAGAGATAAAAACTTCTCAACATT
GCAGACGGTGCTATGTGCTACAGGAGGTGGTGCTTACAAGTTTGAAAAAGATTTTCGCACAATTGGAAACCTCCACCTGC
ACAAACTGGATGAACTTGACTGCCTTGTAAAGGGCTTGCTGTATATAGACTCTGTCAGTTTCAATGGACAAGCCGAGTGC
TATTATTTTGCTAATGCCTCAGAACCTGAGCGATGCCAAAAGATGCCTTTTAACCTGGATGATCCCTATCCACTGCTTGT
AGTGAACATTGGCTCAGGAGTCAGTATTTTAGCAGTCCATTCCAAAGACAACTATAAACGAGTGACTGGGACAAGCCTTG
GAGGGGGTACCTTTCTGGGTTTATGCAGTTTATTGACTGGCTGTGAAAGTTTTGAAGAGGCTCTTGAAATGGCATCCAAA
GGTGATAGCACACAAGCTGACAAGCTGGTCCGTGATATTTATGGAGGAGATTATGAAAGATTTGGTTTGCCAGGTTGGGC
TGTAGCATCTAGTTTTGGGAATATGATTTATAAGGAGAAGCGAGAATCTGTTAGTAAAGAAGATCTGGCAAGAGCTACTT
TAGTTACTATCACCAATAACATTGGTTCTGTGGCACGAATGTGTGCTGTTAATGAGAAAATAAACAGAGTTGTCTTTGTT
GGAAACTTTTTACGTGTCAATACCCTCTCAATGAAACTTTTGGCATATGCACTGGATTACTGGTCAAAAGGTCAACTAAA
AGCATTGTTTCTAGAACATGAGGGTTACTTTGGAGCAGTTGGTGCACTTCTTGGGCTGCCAAATTTCAGCTAG

Protein (370aa)

>JHU00347
MKIKDAKKPSFPWFGMDIGGTLVKLSYFEPIDITAEEEQEEVESLKSIRKYLTSNVAYGSTGIRDVHLELKDLTLFGRRG
NLHFIRFPTQDLPTFIQMGRDKNFSTLQTVLCATGGGAYKFEKDFRTIGNLHLHKLDELDCLVKGLLYIDSVSFNGQAEC
YYFANASEPERCQKMPFNLDDPYPLLVVNIGSGVSILAVHSKDNYKRVTGTSLGGGTFLGLCSLLTGCESFEEALEMASK
GDSTQADKLVRDIYGGDYERFGLPGWAVASSFGNMIYKEKRESVSKEDLARATLVTITNNIGSVARMCAVNEKINRVVFV
GNFLRVNTLSMKLLAYALDYWSKGQLKALFLEHEGYFGAVGALLGLPNFS