Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00346 OSGEPL1 GCP1 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
23 1 1 JHU00346
23 1 2 JHU00346
HuProt v3.0
Block Row Column Clone
4 1 18 JHU00346
4 2 18 JHU00346
HuProt v3.1
Block Row Column Clone
4 1 18 JHU00346
4 2 18 JHU00346

External Database ID

Nucleotide (1245bp)

>JHU00346
ATGCTAATCTTGACTAAGACTGCAGGAGTTTTTTTTAAACCATCAAAAAGGAAAGTTTATGAATTTTTAAGAAGTTTTAA
TTTTCATCCTGGAACACTATTTCTTCATAAAATAGTATTGGGAATTGAAACTAGTTGTGATGATACAGCAGCTGCTGTGG
TGGATGAAACTGGAAATGTGTTGGGAGAAGCAATACATTCCCAAACTGAAGTTCATTTAAAAACAGGTGGGATTGTTCCT
CCAGCAGCTCAACAGCTTCACAGAGAAAATATTCAACGAATAGTACAAGAAGCTCTTTCTGCCAGTGGAGTCTCTCCAAG
TGACCTCTCAGCAATTGCAACTACCATAAAACCAGGACTTGCTTTAAGCCTGGGAGTGGGCTTATCATTTAGCTTACAGC
TGGTAGGACAGTTAAAAAAGCCATTCATTCCCATTCATCATATGGAGGCTCATGCACTTACTATTAGGTTGACCAATAAA
GTAGAATTTCCTTTTTTAGTTCTTTTGATTTCTGGAGGTCACTGTCTGTTGGCATTAGTTCAAGGAGTTTCAGATTTTCT
GCTTCTTGGAAAGTCTTTGGACATAGCACCAGGTGACATGCTTGACAAGGTGGCAAGAAGACTTTCTTTAATAAAACATC
CAGAGTGCTCCACCATGAGTGGTGGGAAAGCCATAGAACATTTGGCCAAACAAGGAAATAGATTTCATTTTGACATCAAA
CCTCCCTTGCATCATGCTAAAAATTGTGATTTTTCTTTTACTGGACTTCAACACGTTACTGATAAAATAATAATGAAAAA
GGAAAAAGAGGAAGGTATTGAGAAGGGGCAAATCCTGTCTTCAGCAGCAGACATTGCTGCCACAGTACAGCACACAATGG
CATGTCATCTTGTGAAAAGAACACATCGGGCTATTCTGTTTTGTAAGCAGAGAGACTTGTTACCTCAAAATAATGCAGTA
CTGGTTGCATCTGGTGGTGTCGCAAGTAACTTCTATATCCGCAGAGCTCTGGAAATTTTAACAAACGCAACACAGTGCAC
TTTGTTGTGTCCTCCTCCCAGACTATGCACTGATAATGGCATTATGATTGCATGGAATGGTATTGAAAGACTACGTGCTG
GCTTGGGCATTTTACATGACATAGAAGGCATCCGCTATGAACCAAAATGTCCTCTTGGAGTAGACATATCAAAAGAAGTT
GGAGAAGCTTCCATAAAAGTACCACAATTAAAAATGGAGATATAG

Protein (414aa)

>JHU00346
MLILTKTAGVFFKPSKRKVYEFLRSFNFHPGTLFLHKIVLGIETSCDDTAAAVVDETGNVLGEAIHSQTEVHLKTGGIVP
PAAQQLHRENIQRIVQEALSASGVSPSDLSAIATTIKPGLALSLGVGLSFSLQLVGQLKKPFIPIHHMEAHALTIRLTNK
VEFPFLVLLISGGHCLLALVQGVSDFLLLGKSLDIAPGDMLDKVARRLSLIKHPECSTMSGGKAIEHLAKQGNRFHFDIK
PPLHHAKNCDFSFTGLQHVTDKIIMKKEKEEGIEKGQILSSAADIAATVQHTMACHLVKRTHRAILFCKQRDLLPQNNAV
LVASGGVASNFYIRRALEILTNATQCTLLCPPPRLCTDNGIMIAWNGIERLRAGLGILHDIEGIRYEPKCPLGVDISKEV
GEASIKVPQLKMEI