Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00344 NRBF2 COPR Homo sapiens Yes Kinases; Nuclear Proteins

HuProt v2.0
Block Row Column Clone
31 1 9 JHU00344
31 1 10 JHU00344
HuProt v3.0
Block Row Column Clone
2 1 28 JHU00344
2 2 28 JHU00344
HuProt v3.1
Block Row Column Clone
2 1 28 JHU00344
2 2 28 JHU00344

External Database ID

Nucleotide (864bp)

>JHU00344
ATGGAAGTAATGGAAGGACCCCTCAACCTGGCTCATCAACAGAGCAGACGAGCAGACCGTTTATTAGCTGCAGGCAAATA
CGAAGAGGCTATTTCTTGTCACAAAAAGGCTGCAGCATATCTTTCTGAAGCCATGAAGCTGACACAGTCAGAGCAGGCTC
ATCTTTCACTGGAATTGCAAAGGGATAGCCATATGAAACAGCTCCTCCTCATCCAAGAGAGATGGAAAAGGGCCCAGCGT
GAAGAAAGATTGAAAGCCCAGCAGAACACAGACAAGGATGCAGCTGCCCATCTTCAGACATCTCACAAACCCTCTGCAGA
GGATGCAGAGGGCCAGAGTCCCCTTTCTCAGAAGTACAGCCCTTCCACAGAGAAATGCCTGCCTGAGATTCAGGGGATCT
TTGACAGGGATCCAGACACACTACTTTATTTACTTCAGCAAAAGAGTGAGCCAGCAGAGCCATGTATTGGAAGCAAAGCC
CCAAAAGATGATAAAACAATTATAGAGGAGCAGGCAACCAAAATTGCAGATTTGAAGAGGCATGTGGAATTCCTTGTGGC
TGAGAATGAAAGATTAAGGAAAGAAAATAAACAACTAAAGGCTGAAAAGGCCAGACTTCTAAAAGGTCCAATAGAAAAGG
AGCTGGATGTAGATGCTGATTTTGTAGAAACGTCAGAGTTATGGAGCTTGCCACCACATGCAGAAACTGCTACAGCCTCC
TCAACCTGGCAGAAGTTCGCAGCAAATACTGGGAAAGCCAAGGACATTCCAATCCCCAATCTTCCTCCCTTGGATTTTCC
ATCTCCAGAACTTCCTCTTATGGAGCTCTCTGAGGATATTCTGAAAGGATTTATGAATAATTAG

Protein (287aa)

>JHU00344
MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQR
EERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKA
PKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATAS
STWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN