Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU26022 MBNL3 CHCR;MBLX39;MBXL Homo sapiens No Nuclear Proteins

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
23 61 3 JHU26022
23 62 3 JHU26022

External Database ID

Nucleotide (1062bp)

>JHU26022
ATGACGGCTGTCAATGTTGCCCTGATTCGTGATACCAAGTGGCTGACTTTAGAAGTCTGTAGAGAATTTCAGAGAGGAAC
TTGCTCTCGAGCTGATGCAGATTGCAAGTTTGCCCATCCACCAAGAGTTTGCCATGTGGAAAATGGTCGTGTGGTGGCCT
GTTTTGATTCTCTAAAGGGTCGGTGTACCCGAGAGAACTGCAAGTACCTTCACCCTCCTCCACACTTAAAAACGCAGCTG
GAGATTAATGGGCGGAACAATCTGATTCAACAGAAGACTGCCGCAGCCATGTTCGCCCAGCAGATGCAGCTTATGCTCCA
AAACGCTCAAATGTCATCACTTGGTTCTTTTCCTATGACTCCATCAATTCCAGCTAATCCTCCCATGGCTTTCAATCCTT
ACATACCACATCCTGGGATGGGCCTCGTTCCTGCAGAACTTGTACCAAATACACCTGTTCTGATTCCTGGAAACCCACCT
CTTGCAATGCCAGGAGCTGTTGGCCCAAAACTGATGCGTTCAGATAAACTGGAGGTTTGCCGAGAATTTCAGCGTGGAAA
TTGTACCCGTGGGGAGAATGATTGCCGCTATGCTCACCCTACTGATGCTTCCATGATTGAAGCGAGTGATAATACTGTGA
CAATCTGCATGGATTACATCAAAGGTCGATGCTCGCGGGAGAAATGCAAGTACTTTCATCCTCCTGCACACTTGCAAGCC
AGACTCAAGGCAGCTCATCATCAGATGAACCATTCAGCTGCCTCTGCCATGGCCCTGCAGCCTGGTACACTGCAACTGAT
ACCAAAGAGATCAGCACTGGAAAAGCCCAATGGTGCCACCCCGGTCTTTAATCCCACTGTTTTCCACTGCCAACAGGCTC
TGACTAACCTGCAGCTCCCACAGCCGGCATTTATCCCTGCAGGGCCAATACTGTGCATGGCACCCGCTTCAAATATTGTG
CCCATGATGCACGGTGCTACACCTACCACTGTGTCTGCAGCAACAACACCTGCCACCAGCGTTCCGTTCGCTGCACCAAC
TACAGGCAATCAGCTGAAATTC

Protein (354aa)

>JHU26022
MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKGRCTRENCKYLHPPPHLKTQL
EINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPP
LAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQA
RLKAAHHQMNHSAASAMALQPGTLQLIPKRSALEKPNGATPVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIV
PMMHGATPTTVSAATTPATSVPFAAPTTGNQLKF