Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU25849 LRRC14B Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
22 61 30 JHU25849
22 62 30 JHU25849

External Database ID

Nucleotide (1542bp)

>JHU25849
ATGGACACAATGAGGTCACTCCGCTTCATTTCTGCAGAAGCTCTGGTGTCCCACCCCCAGGTGGCCCGGCAGAGCCTGGA
CAGCGTGGCCCACAACCTCTACCCACTCCTGTTCAAAGCCAGCTACCTGCTGGAGCAGGCGGAGGTGACGCGCGCGGTGC
TGGGGCGCTGGCCCCTGGAGGAGTTCCGGCTGGGAGCGCTGCTGGGTCCTGGTGCCGACCACCCCCAGGACCTGCGCGAC
AGAACCTGCAGGGCCTGCCTGGAGGCGCTGGTGCGCGGCCTCGCGGACCACGTGCTGCAGGACCGGAGCCGCCGGCGGCT
GCGGGTGGCTGACCTCACGGGCATCCGAGATGTGCAGGTGCAGCGGTGCCCGTGCGGGAGGGCGCTGGGCAGGTGGGGCC
GCACCCAGCTGCTGGCCAGGACCTGCTGTGAGCTGCAGGCAGAGCCCCTCGCAGCCGGGCGCCCCGTCGAGGTCCTCGCC
GACCTCTTCGTCACTGAGGGCAACTTCGAGGCGGTGGTGCAGGCTCTGAGGCCAGCGGGCCCGGCCCCTCTGCGGGTGCA
CTGCCCCTCGTTCCGGGCGGACAGCCTGAGCCCCAGCCAGCTCCTGCACGTGCTGCGTCTGGCTGGCCCGGGTGCCCTGC
GCAAGCTGGAGGTGGTGCACAACGTGCGGCTGCATGCGGGCCACGTGCAGCAGCTTCTGGCCCAGGTGGGCTTCCCCCGG
CTGGCCTCGCTCACCCTGCCCACCAAGGCCTTTGATGCACCCCCCACCTACGCCTCCACTCCCGACGGCGAGGACCCCCT
CCTCGCCTCCATCGCCCGGGAGCTCAGCAAGATGGCGCAGCTCACTGAGCTCAGTGTGGCCTTCTCCACGCTGACCGGGA
AGATCCCGACGCTGCTTGGCCCCCTACAGACCCCGCTGCGAGTACTGGACCTGGCCAACTGTGCCCTGAACCACACGGAC
ATGGCCTTCTTGGCAGACTGTGCCCACGCTGCCCACCTGGAGGTGCTGGACCTCAGTGGACACAACCTGGTCAGCCTGTA
CCCCTCGACCTTCTTCAGGCTGCTCAGCCAGGCTTCCCGGACGCTGAGGATCCTGACACTGGAGGAGTGTGGCATCGTAG
ACAGCCACGTTGGCATGCTGATCCTGGGCCTGAGCCCCTGCCACCGGCTGCGCCAGCTCAAGTTCCTCGGGAACCCGCTG
TCGGCCCGCGCCCTCCGGCGCCTCTTCACCGCACTCTGTGAGCTCCCCGAGCTGCGCTGCATTGAGTTCCCGGTGCCCAA
GGACTGCTACCCCGAGGGTGCCGCCTACCCACAGGACGAGCTGGCCATGTCCAAGTTCAACCAGCAGAAATACGACGAGA
TCGCCGAGGAGCTGCGTGCCGTGCTGCTGCGGGCTGACCGAGAGGACATCCAAGTCTCCACACCTCTCTTTGGAAGTTTT
GACCCAGACATTCAAGAAACAAGCAATGAGCTTGGTGCTTTCTTGCTGCAAGCTTTCAAAACTGCTCTAGAAAACTTCTC
CAGAGCACTCAAACAAATAGAG

Protein (514aa)

>JHU25849
MDTMRSLRFISAEALVSHPQVARQSLDSVAHNLYPLLFKASYLLEQAEVTRAVLGRWPLEEFRLGALLGPGADHPQDLRD
RTCRACLEALVRGLADHVLQDRSRRRLRVADLTGIRDVQVQRCPCGRALGRWGRTQLLARTCCELQAEPLAAGRPVEVLA
DLFVTEGNFEAVVQALRPAGPAPLRVHCPSFRADSLSPSQLLHVLRLAGPGALRKLEVVHNVRLHAGHVQQLLAQVGFPR
LASLTLPTKAFDAPPTYASTPDGEDPLLASIARELSKMAQLTELSVAFSTLTGKIPTLLGPLQTPLRVLDLANCALNHTD
MAFLADCAHAAHLEVLDLSGHNLVSLYPSTFFRLLSQASRTLRILTLEECGIVDSHVGMLILGLSPCHRLRQLKFLGNPL
SARALRRLFTALCELPELRCIEFPVPKDCYPEGAAYPQDELAMSKFNQQKYDEIAEELRAVLLRADREDIQVSTPLFGSF
DPDIQETSNELGAFLLQAFKTALENFSRALKQIE