Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00336 MYOT TTID Homo sapiens Yes Membrane Proteins

HuProt v2.0
Block Row Column Clone
7 1 9 JHU00336
7 1 10 JHU00336
HuProt v3.0
Block Row Column Clone
2 1 10 JHU00336
2 2 10 JHU00336
HuProt v3.1
Block Row Column Clone
2 1 10 JHU00336
2 2 10 JHU00336

External Database ID

Nucleotide (1497bp)

>JHU00336
ATGTTTAACTACGAACGTCCAAAACACTTCATCCAGTCCCAAAACCCATGTGGCTCCAGATTGCAGCCTCCTGGACCAGA
AACCTCCAGCTTCTCTAGCCAGACCAAACAGTCTTCCATTATTATCCAGCCCCGCCAGTGTACAGAGCAAAGATTTTCTG
CCTCCTCAACACTGAGCTCTCACATCACCATGTCCTCCTCTGCTTTCCCTGCTTCTCCCCAGCAGCATGCTGGCTCCAAC
CCAGGCCAAAGGGTTACAACCACCTATAACCAGTCCCCAGCCAGCTTCCTCAGCTCCATATTACCATCACAGCCTGATTA
CAATAGCAGTAAAATCCCTTCCGCTATGGATTCCAACTATCAACAGTCCTCAGCTGGCCAACCTATAAATGCAAAGCCAT
CCCAAACTGCAAATGCTAAGCCCATACCAAGAACTCCTGATCATGAAATACAAGGATCAAAAGAAGCTTTGATTCAAGAT
TTGGAAAGAAAGCTGAAATGCAAGGACACCCTTCTTCATAATGGAAATCAACGTCTAACATATGAAGAGAAGATGGCTCG
CAGATTGCTAGGACCACAGAATGCAGCTGCTGTGTTTCAAGCTCAGGATGACAGTGGTGCACAAGACTCGCAGCAACACA
ACTCAGAACATGCGCGACTGCAAGTTCCTACATCACAAGTAAGAAGTAGATCAACCTCAAGGGGAGATGTGAATGATCAG
GATGCAATCCAGGAGAAATTTTACCCACCACGTTTCATTCAAGTGCCAGAGAACATGTCGATTGATGAAGGAAGATTCTG
CAGAATGGACTTCAAAGTGAGTGGACTGCCAGCTCCTGATGTGTCATGGTATCTAAATGGAAGAACAGTTCAATCAGATG
ATTTGCACAAAATGATAGTGTCTGAGAAGGGTCTTCATTCACTCATCTTTGAAGTAGTCAGAGCTTCAGATGCAGGGGCT
TATGCATGTGTTGCCAAGAATAGAGCAGGAGAAGCCACCTTCACTGTGCAGCTGGATGTCCTTGCAAAAGAACATAAAAG
AGCACCAATGTTTATCTACAAACCACAGAGCAAAAAAGTTTTAGAGGGAGATTCAGTGAAACTAGAATGCCAGATCTCGG
CTATACCTCCACCAAAGCTTTTCTGGAAAAGAAATAATGAAATGGTACAATTCAACACTGACCGAATAAGCTTATATCAA
GATAACACTGGAAGAGTTACTTTACTGATAAAAGATGTAAACAAGAAAGATGCTGGGTGGTATACTGTGTCAGCAGTTAA
TGAAGCTGGAGTGACTACATGTAACACAAGATTAGACGTTACGGCACGTCCAAACCAAACTCTTCCAGCTCCTAAGCAGT
TACGGGTTCGACCAACATTCAGCAAATATTTAGCACTTAATGGGAAAGGTTTGAATGTAAAACAAGCTTTTAACCCAGAA
GGAGAATTTCAGCGTTTGGCAGCTCAATCTGGACTCTATGAAAGTGAAGAACTTTAG

Protein (498aa)

>JHU00336
MFNYERPKHFIQSQNPCGSRLQPPGPETSSFSSQTKQSSIIIQPRQCTEQRFSASSTLSSHITMSSSAFPASPQQHAGSN
PGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDSNYQQSSAGQPINAKPSQTANAKPIPRTPDHEIQGSKEALIQD
LERKLKCKDTLLHNGNQRLTYEEKMARRLLGPQNAAAVFQAQDDSGAQDSQQHNSEHARLQVPTSQVRSRSTSRGDVNDQ
DAIQEKFYPPRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGA
YACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQ
DNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPE
GEFQRLAAQSGLYESEEL