Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU25823 LRRK1 KIAA1790 Homo sapiens No Kinases; Signal Transduction

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
22 61 10 JHU25823
22 62 10 JHU25823

External Database ID

Nucleotide (6045bp)

>JHU25823
ATGGCTGGCATGTCGCAAAGACCCCCCAGCATGTACTGGTGTGTGGGGCCGGAGGAGTCAGCTGTGTGTCCAGAACGTGC
CATGGAGACGCTTAACGGTGCCGGGGACACGGGCGGCAAGCCGTCCACGCGGGGCGGTGACCCTGCAGCGCGGTCCCGCA
GGACGGAAGGCATCCGCGCCGCGTACAGGCGGGGAGACCGCGGCGGCGCCCGGGACCTGCTGGAGGAGGCCTGCGACCAG
TGCGCGTCCCAGCTGGAAAAGGGCCAGCTTCTGAGCATCCCGGCAGCCTATGGGGATCTGGAGATGGTCCGCTACCTACT
CAGCAAGAGACTGGTGGAGCTGCCCACCGAGCCCACGGATGACAACCCAGCCGTGGTGGCAGCGTATTTTGGACACACGG
CAGTTGTGCAGGAATTGCTTGAGTCCTTACCAGGTCCCTGCAGTCCCCAGCGGCTTCTGAACTGGATGCTGGCCTTGGCT
TGCCAGCGAGGGCACCTGGGGGTTGTGAAGCTCCTGGTCCTGACGCACGGGGCTGACCCGGAGAGCTACGCTGTCAGGAA
GAATGAGTTCCCTGTCATCGTGCGCTTGCCCCTGTATGCGGCCATCAAGTCAGGGAATGAAGACATTGCAATATTCCTGC
TTCGGCATGGGGCCTATTTCTGTTCCTACATCTTGCTGGATAGTCCTGACCCCAGCAAACATCTGCTGAGAAAGTACTTC
ATTGAAGCCAGTCCCTTGCCCAGCAGTTATCCGGGAAAAACAGCTCTCCGTGTGAAATGGTCCCATCTCAGACTGCCCTG
GGTAGACCTAGACTGGCTCATAGACATCTCCTGCCAGATCACGGAGCTCGACCTTTCTGCCAACTGCCTGGCGACCCTCC
CCTCGGTTATCCCCTGGGGCCTCATCAATCTCCGGAAGCTGAACCTCTCCGACAACCACCTGGGGGAGCTGCCTGGCGTG
CAGTCATCGGACGAAATCATCTGTTCCAGGCTACTTGAAATTGACATTTCCAGCAACAAGTTGTCCCACCTCCCTCCTGG
ATTCTTGCACCTCTCAAAACTTCAAAAACTGACAGCTTCAAAAAATTGTTTAGAAAAATTGTTCGAAGAAGAAAATGCCA
CTAACTGGATAGGTTTACGGAAGCTACAGGAACTTGATATATCTGACAATAAATTGACAGAACTCCCTGCCCTGTTCCTT
CACTCTTTCAAGTCCCTCAATTCTCTGAATGTCTCCAGAAACAACCTGAAGGTGTTTCCAGATCCCTGGGCCTGCCCTTT
GAAATGTTGTAAAGCTTCCAGAAATGCCCTGGAATGTCTGCCAGACAAAATGGCTGTCTTTTGGAAAAATCACCTGAAGG
ATGTGGATTTCTCAGAAAACGCACTCAAAGAAGTTCCCCTGGGACTTTTCCAGCTTGATGCCCTCATGTTCTTGAGGTTA
CAGGGGAACCAGCTGGCGGCACTTCCACCTCAAGAGAAGTGGACCTGCAGGCAGCTCAAAACCCTGGATCTCTCCAGAAA
CCAACTTGGCAAAAATGAAGATGGACTGAAAACGAAGCGTATTGCCTTTTTCACCACCAGAGGTCGCCAGCGCTCCGGGA
CTGAGGCAGCAAGTGTGCTGGAATTTCCGGCCTTCCTAAGTGAGTCTTTGGAAGTCCTTTGCCTGAACGACAACCACCTC
GACACAGTCCCTCCCTCGGTTTGCCTACTGAAGAGCTTATCAGAGCTCTACTTGGGAAACAACCCTGGCCTCCGGGAGCT
CCCTCCTGAGCTGGGGCAGCTGGGCAACCTCTGGCAGCTGGACACTGAAGACCTGACCATCAGCAATGTGCCTGCAGAAA
TCCAAAAAGAAGGCCCCAAAGCAATGCTGTCTTACCTGCGTGCTCAGCTGCGGAAAGCGGAAAAGTGCAAGCTGATGAAG
ATGATCATCGTGGGTCCCCCGCGCCAGGGCAAGTCCACCCTCCTGGAGATCTTACAGACGGGGAGGGCCCCCCAGGTGGT
GCATGGAGAGGCCACCATCAGGACCACCAAGTGGGAGCTCCAGAGGCCGGCTGGCTCAAGAGCCAAGGTTGAGTCCGTGG
AGTTCAACGTCTGGGACATCGGGGGACCGGCCAGCATGGCCACTGTCAACCAGTGCTTCTTCACGGACAAGGCCCTGTAC
GTGGTGGTCTGGAACCTGGCGCTGGGGGAGGAGGCCGTGGCCAACCTCCAGTTCTGGCTGCTCAACATCGAGGCCAAGGC
CCCAAACGCCGTGGTGCTGGTGGTCGGGACGCACCTGGATTTAATTGAAGCCAAGTTCCGTGTGGAAAGGATTGCAACGC
TGCGTGCCTATGTGCTGGCACTCTGCCGCTCCCCCTCCGGCTCCAGGGCCACAGGCTTCCCAGACATCACCTTCAAACAC
TTACATGAGATTTCCTGCAAGAGCCTGGAAGGTCAGGAAGGGCTGCGACAGCTGATTTTCCACGTCACGTGCAGCATGAA
GGACGTGGGCAGCACCATCGGCTGCCAGCGACTGGCAGGGCGGCTGATCCCCAGGAGCTACCTGAGCCTGCAGGAGGCCG
TGCTGGCAGAGCAGCAGCGCCGCAGCCGGGACGACGACGTGCAGTACCTGACGGACAGGCAGCTGGAGCAGCTGGTGGAG
CAGACGCCCGACAACGACATCAAGGACTACGAGGACCTGCAGTCAGCCATCAGCTTCCTCATAGAAACCGGCACCCTGCT
CCATTTCCCGGACACCAGCCACGGCCTGAGGAACCTCTACTTCCTCGACCCTATTTGGCTCTCCGAATGTCTGCAGAGGA
TCTTTAATATTAAGGGCTCTCGGTCAGTGGCCAAGAATGGGGTGATCAGAGCAGAAGACCTCAGGATGCTGCTGGTGGGG
ACTGGCTTCACGCAGCAGACGGAAGAGCAGTACTTCCAGTTCCTGGCCAAGTTTGAGATCGCCCTGCCCGTCGCCAATGA
CAGCTACCTCCTGCCCCATCTCCTTCCATCTAAACCTGGCCTGGACACCCACGGTATGCGGCACCCCACAGCCAACACCA
TTCAGAGGGTATTTAAGATGAGCTTCGTTCCCGTTGGCTTCTGGCAAAGGTTTATAGCACGGATGCTGATCAGCCTGGCG
GAGATGGACCTGCAGCTTTTTGAAAACAAGAAGAATACTAAAAGCAGGAACAGGAAAGTCACCATTTACAGTTTTACAGG
AAACCAGAGAAATCGCTGTAGCACATTCAGAGTGAAAAGAAATCAGACCATCTATTGGCAGGAAGGGCTCCTGGTCACTT
TTGATGGGGGCTACCTCAGTGTGGAATCTTCCGACGTGAACTGGAAAAAGAAGAAAAGCGGAGGAATGAAAATTGTTTGC
CAATCAGAAGTGAGGGACTTCTCAGCCATGGCTTTCATCACGGACCACGTCAATTCCTTGATTGATCAGTGGTTTCCCGC
CCTGACAGCCACAGAGAGCGACGGGACGCCACTCATGGAGCAGTACGTGCCCTGCCCGGTCTGCGAGACAGCCTGGGCCC
AGCACACGGACCCCAGTGAGAAATCAGAGGATGTGCAGTACTTCGACATGGAAGACTGTGTCCTGACGGCCATCGAGCGG
GACTTCATCTCCTGCCCCAGACACCCGGACCTCCCCGTGCCGCTGCAGGAGCTGGTCCCTGAACTGTTCATGACCGACTT
CCCGGCCAGGCTCTTCCTGGAGAACAGCAAGCTGGAGCACAGCGAGGACGAGGGCAGCGTCCTGGGCCAGGGCGGCAGTG
GCACCGTCATCTACCGGGCCCGGTACCAGGGCCAGCCTGTGGCCGTCAAGCGCTTCCACATCAAAAAATTCAAGAACTTT
GCTAACGTACCGGCAGACACCATGCTGAGGCACCTGCGGGCCACCGATGCCATGAAGAACTTCTCCGAGTTCCGGCAGGA
GGCCAGCATGCTGCACGCGCTGCAGCACCCCTGCATCGTGGCGCTCATCGGCATCAGCATCCACCCGCTCTGCTTCGCCC
TGGAGCTCGCGCCGCTCAGCAGCCTCAACACCGTGCTGTCCGAGAACGCCAGAGATTCTTCCTTTATACCCCTGGGACAC
ATGCTCACCCAAAAAATAGCCTACCAGATCGCCTCGGGCCTGGCCTACCTGCACAAGAAAAACATCATCTTCTGTGACCT
GAAGTCGGACAACATTCTGGTGTGGTCCCTTGACGTCAAGGAGCACATCAACATCAAGCTATCTGACTACGGGATTTCGA
GGCAGTCATTCCATGAGGGCGCCCTAGGCGTGGAGGGCACTCCTGGCTACCAGGCCCCAGAGATCAGGCCTCGCATTGTA
TATGATGAGAAGGTAGATATGTTCTCCTATGGAATGGTGCTCTACGAGTTGCTGTCAGGACAGCGCCCTGCACTGGGCCA
CCACCAGCTCCAGATTGCCAAGAAGCTGTCCAAGGGCATCCGCCCGGTTCTGGGGCAGCCGGAGGAAGTGCAGTTCCGGC
GACTGCAGGCGCTCATGATGGAGTGCTGGGACACTAAGCCAGAGAAGCGACCGCTGGCCCTGTCGGTGGTGAGCCAGATG
AAGGACCCGACTTTTGCCACCTTCATGTATGAACTGTGCTGTGGGAAGCAGACAGCCTTCTTCTCATCCCAGGGCCAGGA
GTACACCGTGGTGTTTTGGGATGGAAAAGAGGAGTCCAGGAACTACACGGTGGTGAACACAGAGAAGGGCCTCATGGAGG
TGCAGAGGATGTGCTGCCCTGGGATGAAGGTGAGCTGCCAGCTCCAGGTCCAGAGATCCCTGTGGACAGCCACCGAGGAC
CAGAAAATCTACATCTACACCCTCAAGGGCATGTGCCCCTTAAACACACCCCAACAGGCCTTGGATACTCCAGCTGTCGT
CACCTGCTTCTTGGCCGTGCCTGTTATTAAAAAGAATTCCTACCTGGTCTTAGCGGGCCTCGCCGATGGGCTTGTGGCTG
TGTTTCCCGTGGTGCGGGGCACCCCAAAGGACAGCTGCTCCTACCTGTGCTCACACACAGCCAACAGGTCCAAGTTCAGC
ATCGCGGATGAAGACGCACGGCAGAACCCCTACCCAGTGAAGGCCATGGAGGTGGTCAACAGCGGCTCTGAGGTCTGGTA
CAGCAATGGGCCGGGCCTCCTTGTCATCGACTGTGCCTCCCTGGAGATCTGCAGGCGGCTGGAGCCCTACATGGCCCCCT
CCATGGTTACGTCAGTCGTGTGCAGCTCTGAGGGCAGAGGGGAGGAGGTCGTCTGGTGCCTGGATGACAAGGCCAACTCC
TTGGTGATGTACCACTCCACCACCTACCAGCTGTGTGCCCGGTACTTCTGCGGGGTCCCCAGCCCCCTCAGGGACATGTT
TCCCGTGCGGCCCTTGGACACGGAACCCCCGGCAGCCAGCCACACGGCCAACCCAAAGGTGCCTGAGGGGGACTCCATCG
CGGACGTGAGCATCATGTACAGTGAGGAGCTGGGCACGCAGATCCTGATCCACCAGGAATCACTCACTGACTACTGCTCC
ATGTCCTCCTACTCCTCATCCCCACCCCGCCAGGCTGCCAGGTCCCCCTCAAGCCTCCCCAGCTCCCCAGCAAGTTCTTC
CAGTGTGCCTTTCTCCACCGACTGCGAGGACTCAGACATGCTACATACGCCCGGTGCTGCCTCCGACAGGTCTGAGCATG
ACCTGACCCCCATGGACGGGGAGACCTTCAGCCAGCACCTGCAGGCCGTGAAGATCCTCGCCGTCAGAGACCTCATTTGG
GTCCCCAGGCGCGGTGGAGATGTTATCGTCATTGGCCTGGAGAAGGATTCTGGCGCCCAGCGGGGCCGAGTCATTGCCGT
CTTAAAAGCCCGAGAGCTGACTCCGCATGGGGTGCTGGTGGATGCTGCCGTGGTGGCAAAGGACACTGTTGTGTGCACCT
TTGAAAATGAAAACACAGAGTGGTGCCTGGCCGTCTGGAGGGGCTGGGGCGCCAGGGAGTTCGACATTTTCTACCAGTCC
TACGAGGAGCTGGGCCGGCTGGAGGCTTGCACTCGCAAGAGAAGG

Protein (2015aa)

>JHU25823
MAGMSQRPPSMYWCVGPEESAVCPERAMETLNGAGDTGGKPSTRGGDPAARSRRTEGIRAAYRRGDRGGARDLLEEACDQ
CASQLEKGQLLSIPAAYGDLEMVRYLLSKRLVELPTEPTDDNPAVVAAYFGHTAVVQELLESLPGPCSPQRLLNWMLALA
CQRGHLGVVKLLVLTHGADPESYAVRKNEFPVIVRLPLYAAIKSGNEDIAIFLLRHGAYFCSYILLDSPDPSKHLLRKYF
IEASPLPSSYPGKTALRVKWSHLRLPWVDLDWLIDISCQITELDLSANCLATLPSVIPWGLINLRKLNLSDNHLGELPGV
QSSDEIICSRLLEIDISSNKLSHLPPGFLHLSKLQKLTASKNCLEKLFEEENATNWIGLRKLQELDISDNKLTELPALFL
HSFKSLNSLNVSRNNLKVFPDPWACPLKCCKASRNALECLPDKMAVFWKNHLKDVDFSENALKEVPLGLFQLDALMFLRL
QGNQLAALPPQEKWTCRQLKTLDLSRNQLGKNEDGLKTKRIAFFTTRGRQRSGTEAASVLEFPAFLSESLEVLCLNDNHL
DTVPPSVCLLKSLSELYLGNNPGLRELPPELGQLGNLWQLDTEDLTISNVPAEIQKEGPKAMLSYLRAQLRKAEKCKLMK
MIIVGPPRQGKSTLLEILQTGRAPQVVHGEATIRTTKWELQRPAGSRAKVESVEFNVWDIGGPASMATVNQCFFTDKALY
VVVWNLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVERIATLRAYVLALCRSPSGSRATGFPDITFKH
LHEISCKSLEGQEGLRQLIFHVTCSMKDVGSTIGCQRLAGRLIPRSYLSLQEAVLAEQQRRSRDDDVQYLTDRQLEQLVE
QTPDNDIKDYEDLQSAISFLIETGTLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIRAEDLRMLLVG
TGFTQQTEEQYFQFLAKFEIALPVANDSYLLPHLLPSKPGLDTHGMRHPTANTIQRVFKMSFVPVGFWQRFIARMLISLA
EMDLQLFENKKNTKSRNRKVTIYSFTGNQRNRCSTFRVKRNQTIYWQEGLLVTFDGGYLSVESSDVNWKKKKSGGMKIVC
QSEVRDFSAMAFITDHVNSLIDQWFPALTATESDGTPLMEQYVPCPVCETAWAQHTDPSEKSEDVQYFDMEDCVLTAIER
DFISCPRHPDLPVPLQELVPELFMTDFPARLFLENSKLEHSEDEGSVLGQGGSGTVIYRARYQGQPVAVKRFHIKKFKNF
ANVPADTMLRHLRATDAMKNFSEFRQEASMLHALQHPCIVALIGISIHPLCFALELAPLSSLNTVLSENARDSSFIPLGH
MLTQKIAYQIASGLAYLHKKNIIFCDLKSDNILVWSLDVKEHINIKLSDYGISRQSFHEGALGVEGTPGYQAPEIRPRIV
YDEKVDMFSYGMVLYELLSGQRPALGHHQLQIAKKLSKGIRPVLGQPEEVQFRRLQALMMECWDTKPEKRPLALSVVSQM
KDPTFATFMYELCCGKQTAFFSSQGQEYTVVFWDGKEESRNYTVVNTEKGLMEVQRMCCPGMKVSCQLQVQRSLWTATED
QKIYIYTLKGMCPLNTPQQALDTPAVVTCFLAVPVIKKNSYLVLAGLADGLVAVFPVVRGTPKDSCSYLCSHTANRSKFS
IADEDARQNPYPVKAMEVVNSGSEVWYSNGPGLLVIDCASLEICRRLEPYMAPSMVTSVVCSSEGRGEEVVWCLDDKANS
LVMYHSTTYQLCARYFCGVPSPLRDMFPVRPLDTEPPAASHTANPKVPEGDSIADVSIMYSEELGTQILIHQESLTDYCS
MSSYSSSPPRQAARSPSSLPSSPASSSSVPFSTDCEDSDMLHTPGAASDRSEHDLTPMDGETFSQHLQAVKILAVRDLIW
VPRRGGDVIVIGLEKDSGAQRGRVIAVLKARELTPHGVLVDAAVVAKDTVVCTFENENTEWCLAVWRGWGAREFDIFYQS
YEELGRLEACTRKRR