Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU25818 PDE4DIP CMYA2;KIAA0454;KIAA0477;MMGL Homo sapiens No Nuclear Proteins

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
21 61 28 JHU25818
21 62 28 JHU25818

External Database ID

Nucleotide (7038bp)

>JHU25818
ATGTCTAATGGATATCGCACTCTGTCCCAGCACCTCAATGACCTGAAGAAGGAGAACTTCAGCCTCAAGCTGCGCATCTA
CTTCCTGGAGGAGCGCATGCAACAGAAGTATGAGGCCAGCCGGGAGGACATCTACAAGCGGAACATTGAGCTGAAGGTTG
AAGTGGAGAGCTTGAAACGAGAACTCCAGGACAAGAAACAGCATCTGGATAAAACATGGGCTGATGTGGAGAATCTCAAC
AGTCAGAATGAAGCTGAGCTCCGACGCCAGTTTGAGGAGCGACAGCAGGAGACGGAGCATGTTTATGAGCTCTTGGAGAA
TAAGATCCAGCTTCTGCAGGAGGAATCCAGGCTAGCAAAGAATGAAGCTGCGCGGATGGCAGCTCTGGTGGAAGCAGAGA
AGGAGTGTAACCTGGAGCTCTCAGAGAAACTGAAGGGAGTCACCAAAAACTGGGAAGATGTACCAGGAGACCAGGTCAAG
CCCGACCAATACACTGAGGCCCTGGCCCAGAGGGACAAGAGAATTGAAGAACTGAATCAGAGCCTGGCTGCCCAGGAGAG
GCTTGTAGAACAGCTATCTCGGGAGAAACAACAACTGCTACATCTGTTGGAGGAGCCAACTAGCATGGAAGTGCAGCCCA
TGACTGAAGAGTTGCTGAAACAACAAAAGCTGAATTCACATGAGACCACTATAACTCAGCAGTCTGTATCTGATTCCCAC
TTGGCAGAACTCCAGGAAAAAATCCAGCAAACAGAGGCCACCAACAAGATTCTTCAAGAGAAACTTAATGAAATGAGCTA
TGAACTAAAGTGTGCTCAGGAGTCGTCTCAAAAGCAAGATGGTACAATTCAGAACCTCAAGGAAACTCTGAAAAGCAGGG
AACGTGAGACTGAGGAGTTGTACCAGGTAATTGAAGGTCAAAATGACACAATGGCAAAGCTTCGAGAAATGCTGCACCAA
AGCCAGCTTGGACAACTTCACAGCTCAGAGGGTACTTCTCCAGCTCAGCAACAGGTAGCTCTGCTTGATCTTCAGAGTGC
TTTATTCTGCAGCCAACTTGAAATACAGAAGCTCCAGAGGGTGGTACGACAGAAAGAGCGCCAACTGGCTGATGCCAAAC
AATGTGTGCAATTTGTAGAGGCTGCAGCACACGAGAGTGAACAGCAGAAAGAGGCTTCTTGGAAACATAACCAGGAATTG
CGAAAAGCCTTGCAGCAGCTACAAGAAGAATTGCAGAATAAGAGCCAACAGCTTCGTGCCTGGGAGGCTGAAAAATACAA
TGAGATTCGAACCCAGGAACAAAACATCCAGCACCTAAACCATAGTCTGAGTCACAAGGAGCAGTTGCTTCAGGAATTTC
GGGAGCTCCTACAGTATCGAGATAACTCAGACAAAACCCTTGAAGCAAATGAAATGTTGCTTGAGAAACTTCGCCAGCGA
ATACATGATAAAGCTGTTGCTCTGGAGCGGGCTATAGATGAAAAATTCTCTGCTCTAGAAGAGAAAGAAAAAGAACTGCG
CCAGCTTCGTCTTGCTGTGAGAGAGCGAGATCATGACTTAGAGAGACTGCGCGATGTCCTCTCCTCCAATGAAGCTACTA
TGCAAAGTATGGAGAGTCTCCTGAGGGCCAAAGGCCTGGAAGTGGAACAGTTATCTACTACCTGTCAAAACCTCCAGTGG
CTGAAAGAAGAAATGGAAACCAAATTTAGCCGTTGGCAGAAGGAACAAGAGAGTATCATTCAGCAGTTACAGACGTCTCT
TCATGATAGGAACAAAGAAGTGGAGGATCTTAGTGCAACACTGCTCTGCAAACTTGGACCAGGGCAGAGTGAGATAGCAG
AGGAGCTGTGCCAGCGTCTACAGCGAAAGGAAAGGATGCTGCAGGACCTTCTAAGTGATCGAAATAAACAAGTGCTGGAA
CATGAAATGGAGATTCAAGGCCTGCTTCAGTCTGTGAGCACCAGGGAGCAGGAAAGCCAAGCTGCTGCAGAGAAGTTGGT
GCAAGCCTTAATGGAAAGAAATTCAGAATTACAGGCCCTGCGCCAATATTTAGGAGGGAGAGACTCCCTGATGTCCCAAG
CACCCATCTCTAACCAACAAGCTGAAGTTACCCCCACTGGCTGTCTTGGAAAACAGACTGATCAAGGTTCAATGCAGATA
CCTTCCAGAGATGATAGCACTTCATTGACTGCCAAAGAGGATGTCAGCATACCCAGATCCACATTAGGAGACTTGGACAC
AGTTGCAGGGCTGGAAAAAGAACTGAGTAATGCCAAAGAGGAACTTGAACTCATGGCTAAAAAAGAAAGAGAAAGTCAGA
TGGAACTTTCTGCTCTACAGTCCATGATGGCTGTGCAGGAAGAAGAGCTGCAGGTGCAGGCTGCTGATATGGAGTCTCTG
ACCAGGAACATACAGATTAAAGAAGATCTCATAAAGGACCTGCAAATGCAACTGGTTGATCCTGAAGACATACCAGCTAT
GGAACGCCTGACCCAGGAAGTCTTACTTCTTCGGGAAAAAGTTGCTTCAGTAGAATCCCAGGGTCAAGAAATTTCAGGAA
ACCGAAGACAACAGTTGCTGCTGATGCTAGAAGGACTAGTAGATGAACGGAGTCGGCTCAATGAGGCCTTACAAGCAGAG
AGACAGCTCTATAGCAGTCTGGTGAAGTTCCATGCCCATCCAGAGAGCTCTGAGAGAGACCGAACTCTGCAGGTGGAACT
GGAAGGGGCTCAGGTGTTACGCAGTCGGCTAGAAGAAGTTCTTGGAAGAAGCTTGGAGCGCTTAAACAGGCTGGAGACCC
TGGCCGCCATTGGAGGTGCAGCTGCAGGGGATGACACCGAAGATACAAGCACTGAGTTCACTGACAGTATTGAGGAGGAG
GCTGCACACCATAGTCACCAGCAACTTGTCAAGGTGGCTTTGGAGAAAAGTCTGGCAACTGTGGAGACCCAGAACCCATC
TTTTTCCCCTCCTTCTCCGATGGGAGGGGACAGTAACAGGTGTCTTCAGGAAGAAATGCTCCACCTGAGGGCTGAGTTCC
ACCAGCACTTAGAAGAGAAGAGGAAAGCTGAGGAGGAACTGAAGGAGCTAAAGGCTCAAATTGAGGAAGCAGGATTCTCC
TCAGTGTCCCACATCAGGAACACCATGCTGAGCCTTTGCCTTGAGAATGCGGAGCTGAAAGAGCAGATGGGAGAAGCAAT
GTCTGATGGATGGGAGATCGAGGAAGACAAGGAGAAGGGCGAGGTGATGGTTGAGACTGTGGTAACCAAAGAGGGTCTGA
GTGAGAGTAGCCTTCAGGCTGAGTTCAGAAAGCTCCAGGGAAAACTGAAGAATGCCCACAATATCATCAACCTCCTCAAA
GAACAACTTGTGCTGAGTAGCAAGGAAGGGAATAGTAAACTTACTCCAGAGCTCCTTGTGCATCTGACCAGCACCATTGA
AAGAATAAACACAGAACTGGTTGGTTCCCCTGGGAAGCACCAACACCAAGAGGAGGGGAATGTGACTGTGAGGCCTTTCC
CCAGACCCCAGAGCCTTGACCTTGGGGCTACCTTCACAGTGGATGCCCACCAATTGGATAACCAGTCCCAGCCTCGTGAC
CCTGGGCCTCAGTCAGCGTTTAGCCTACCAGGGTCCACCCAGCACCTGCGCTCCCAGCTGTCACAATGCAAACAACGCTA
TCAAGATCTCCAGGAGAAGCTGCTGCTATCAGAAGCCACTGTCTTTGCTCAGGCTAACGAGCTGGAGAAATACAGAGTTA
TGCTTACAGGTGAATCCTTGGTGAAGCAGGACAGCAAGCAGATCCAGGTGGACCTCCAGGACCTGGGCTATGAGACTTGT
GGCCGAAGCGAGAATGAGGCTGAACGGGAGGAAACCACCAGTCCTGAGTGTGAGGAGCACAACAGCCTCAAGGAAATGGT
CCTGATGGAGGGGCTGTGCTCTGAGCAGGGACGCCGGGGCTCAACACTGGCTAGTTCCTCTGAGAGGAAGCCCTTGGAGA
ACCAGCTAGGGAAGCAGGAAGAGTTCCGGGTATATGGAAAGTCAGAAAACATCTTGGTCCTACGAAAGGACATCAAAGAT
CTGAAGGCCCAGCTGCAGAATGCCAACAAGGTCATTCAAAACCTCAAGAGCCGGGTCCGGTCCCTCTCAGTTACAAGTGA
TTATTCGTCTAGTCTGGAAAGACCCTGGAAGCTGAGAGCTGTTGGCACCTTGGAGGGGTCTTCACCTCATAGTGTCCCTG
ATGAGGATGAGGGGTGGCTGTCTGATGGCACTGGGGCTTTCTACTCTCCAGGGCTTCAGGCCAAAAAGGACCTGGAGAGT
CTCATCCAGAGAGTATCCCAGCTGGAGGCCCAGCTCCCAAAAAATGGACTAGAAGAGAAGCTGGCTGAGGAGCTGAGATC
AGCCTCGTGGCCTGGGAAATATGATTCCCTGATTCAGGATCAGGCCCGGGAACTGTCTTACCTACGGCAAAAAATACGAG
AAGGGAGAGGTATTTGTTATCTTATCACCCGGCATGCAAAAGATACAGTAAAATCTTTTGAGGATCTCCTAAGGAGCAAT
GACATTGACTACTACCTGGGACAGAGCTTCCGGGAGCAACTCGCCCAGGGAAGCCAGCTGACAGAGAGGCTCACCAGCAA
ACTCAGCACCAAGGATCATAAAAGTGAGAAAGATCAAGCTGGACTTGAGCCACTGGCCCTCAGGCTCAGCAGGGAGCTGC
AGGAGAAGGAGAAAGTGATTGAAGTCCTGCAGGCCAAGCTGGATGCTCGGTCCCTCACACCCTCCAGCAGCCATGCCTTG
TCTGACTCCCACCGCTCTCCCAGCAGCACCTCTTTCCTGTCTGATGAACTGGAAGCCTGCTCTGACATGGACATAGTCAG
CGAGTACACACACTATGAAGAGAAGAAAGCTTCTCCCAGTCACTCAGATTCCATCCATCATTCGAGTCATTCTGCTGTGT
TGTCTTCTAAACCATCATCAACCAGTGCATCTCAGGGGGCTAAGGCCGAATCCAACAGCAACCCCATCAGCTTGCCAACT
CCCCAGAATACCCCCAAGGAGGCCAACCAGGCCCATTCAGGCTTTCATTTTCACTCCATACCCAAGCTGGCTAGCCTTCC
TCAGGCACCATTGCCCTCAGCTCCATCCAGCTTCCTGCCTTTCAGCCCCACTGGCCCTCTCCTCCTTGGCTGCTGTGAGA
CACCAGTGGTCTCCTTGGCTGAGGCTCAGCAGGAGCTACAGATGCTGCAGAAGCAGTTGGGAGAAAGTGCCAGCACTGTT
CCTCCTGCTTCCACAGCTACATTGCTGAGCAACGACTTGGAAGCCGACTCTTCCTACTACCTCAACTCTGCCCAGCCTCA
CTCTCCTCCAAGGGGCACCATAGAACTGGGAAGAATCCTAGAGCCTGGGTACCTGGGCAGCAGTGGCAAGTGGGATGTGA
TGAGGCCTCAGAAAGGGAGTGTATCTGGGGACCTATCCTCAGGCTCCTCTGTGTACCAGCTTAACTCCAAACCCACAGGG
GCTGACCTGCTGGAAGAGCATCTTGGTGAAATCCGGAACCTGCGCCAGCGCCTGGAGGAATCCATCTGCATCAATGACCG
CCTACGGGAGCAACTGGAACACCGGCTGACCTCTACTGCTCGTGGAAGGGGATCCACTTCTAACTTCTACAGTCAGGGCC
TGGAGTCCATACCTCAGCTCTGCAATGAGAACAGAGTCCTCAGGGAAGACAATCGAAGACTTCAGGCTCAACTGAGTCAT
GTTTCCAGAGAGCACTCCCAGGAAACAGAAAGCCTGAGGGAGGCTCTGCTGTCCTCTCGATCCCACCTTCAAGAGCTGGA
AAAGGAGCTGGAGCACCAGAAGGTGGAAAGGCAGCAGCTTTTGGAAGACTTGAGGGAGAAGCAGCAAGAGGTCTTGCATT
TCAGGGAGGAACGTCTTTCCCTCCAGGAAAACGACTCCAGACTGCAGCACAAGCTGGTTCTCCTGCAGCAACAGTGTGAA
GAGAAACAGCAGCTCTTTGAGTCCCTCCAGTCAGAGCTACAAATCTACGAGGCACTTTATGGCAATTCCAAGAAGGGGCT
GAAAGCTTACAGCCTGGATGCCTGTCACCAAATCCCTTTGAGCAGTGACCTGAGCCACCTGGTGGCAGAGGTACGAGCTC
TGAGAGGGCAGCTGGAGCAGAGCATTCAGGGGAACAATTGTCTGCGACTGCAGCTGCAACAGCAGCTGGAGAGCGGTGCT
GGCAAAGCCAGCCTCAGCCCCTCCTCCATTAACCAGAACTTCCCAGCCAGCACTGACCCTGGAAACAAGCAGCTGCTCCT
CCAAGATTCAGCTGTGTCCCCTCCAGTCCGGGATGTTGGTATGAATTCCCCAGCTCTGGTCTTCCCCAGCTCTGCTTCCT
CTACTCCTGGCTCAGAAACGCCCATAATCAACAGAGCAAATGGCTTGGGTTTGGATACTTCTCCAGTAATGAAGACCCCT
CCCAAGCTAGAGGGTGATGCTACTGATGGCTCCTTTGCCAATAAGCATGGCCGCCATGTCATTGGCCACATTGATGACTA
CAGTGCCCTAAGACAGCAGATTGCGGAGGGCAAGCTGCTGGTCAAAAAGATAGTGTCTCTTGTGAGATCAGCGTGCAGCT
TCCCTGGCCTTGAAGCCCAAGGCACAGAGGTGCTAGGCAGCAAAGGTATTCATGAGCTTCGGAGCAGCACCAGTGCCCTG
CACCATGCCCTAGAGGAGTCAGCTTCCCTCCTCACCATGTTCTGGAGAGCGGCCCTGCCAAGCACCCACATCCCTGTGCT
GCCTGGCAAAGTGGGAGAATCAACAGAAAGGGAACTTCTGGAACTGAGAACCAAAGTATCCAAACAGGAGCGACTCCTTC
AGAGCACAACTGAGCATCTGAAGAACGCCAACCAGCAGAAGGAGAGCATGGAACAGTTCATTGTCAGCCAGCTAACCAGA
ACACATGATGTTTTAAAGAAGGCAAGGACTAACTTAGAGGTGAAATCCCTAAGGGCTCTGCCATGTACTCCAGCCTTG

Protein (2346aa)

>JHU25818
MSNGYRTLSQHLNDLKKENFSLKLRIYFLEERMQQKYEASREDIYKRNIELKVEVESLKRELQDKKQHLDKTWADVENLN
SQNEAELRRQFEERQQETEHVYELLENKIQLLQEESRLAKNEAARMAALVEAEKECNLELSEKLKGVTKNWEDVPGDQVK
PDQYTEALAQRDKRIEELNQSLAAQERLVEQLSREKQQLLHLLEEPTSMEVQPMTEELLKQQKLNSHETTITQQSVSDSH
LAELQEKIQQTEATNKILQEKLNEMSYELKCAQESSQKQDGTIQNLKETLKSRERETEELYQVIEGQNDTMAKLREMLHQ
SQLGQLHSSEGTSPAQQQVALLDLQSALFCSQLEIQKLQRVVRQKERQLADAKQCVQFVEAAAHESEQQKEASWKHNQEL
RKALQQLQEELQNKSQQLRAWEAEKYNEIRTQEQNIQHLNHSLSHKEQLLQEFRELLQYRDNSDKTLEANEMLLEKLRQR
IHDKAVALERAIDEKFSALEEKEKELRQLRLAVRERDHDLERLRDVLSSNEATMQSMESLLRAKGLEVEQLSTTCQNLQW
LKEEMETKFSRWQKEQESIIQQLQTSLHDRNKEVEDLSATLLCKLGPGQSEIAEELCQRLQRKERMLQDLLSDRNKQVLE
HEMEIQGLLQSVSTREQESQAAAEKLVQALMERNSELQALRQYLGGRDSLMSQAPISNQQAEVTPTGCLGKQTDQGSMQI
PSRDDSTSLTAKEDVSIPRSTLGDLDTVAGLEKELSNAKEELELMAKKERESQMELSALQSMMAVQEEELQVQAADMESL
TRNIQIKEDLIKDLQMQLVDPEDIPAMERLTQEVLLLREKVASVESQGQEISGNRRQQLLLMLEGLVDERSRLNEALQAE
RQLYSSLVKFHAHPESSERDRTLQVELEGAQVLRSRLEEVLGRSLERLNRLETLAAIGGAAAGDDTEDTSTEFTDSIEEE
AAHHSHQQLVKVALEKSLATVETQNPSFSPPSPMGGDSNRCLQEEMLHLRAEFHQHLEEKRKAEEELKELKAQIEEAGFS
SVSHIRNTMLSLCLENAELKEQMGEAMSDGWEIEEDKEKGEVMVETVVTKEGLSESSLQAEFRKLQGKLKNAHNIINLLK
EQLVLSSKEGNSKLTPELLVHLTSTIERINTELVGSPGKHQHQEEGNVTVRPFPRPQSLDLGATFTVDAHQLDNQSQPRD
PGPQSAFSLPGSTQHLRSQLSQCKQRYQDLQEKLLLSEATVFAQANELEKYRVMLTGESLVKQDSKQIQVDLQDLGYETC
GRSENEAEREETTSPECEEHNSLKEMVLMEGLCSEQGRRGSTLASSSERKPLENQLGKQEEFRVYGKSENILVLRKDIKD
LKAQLQNANKVIQNLKSRVRSLSVTSDYSSSLERPWKLRAVGTLEGSSPHSVPDEDEGWLSDGTGAFYSPGLQAKKDLES
LIQRVSQLEAQLPKNGLEEKLAEELRSASWPGKYDSLIQDQARELSYLRQKIREGRGICYLITRHAKDTVKSFEDLLRSN
DIDYYLGQSFREQLAQGSQLTERLTSKLSTKDHKSEKDQAGLEPLALRLSRELQEKEKVIEVLQAKLDARSLTPSSSHAL
SDSHRSPSSTSFLSDELEACSDMDIVSEYTHYEEKKASPSHSDSIHHSSHSAVLSSKPSSTSASQGAKAESNSNPISLPT
PQNTPKEANQAHSGFHFHSIPKLASLPQAPLPSAPSSFLPFSPTGPLLLGCCETPVVSLAEAQQELQMLQKQLGESASTV
PPASTATLLSNDLEADSSYYLNSAQPHSPPRGTIELGRILEPGYLGSSGKWDVMRPQKGSVSGDLSSGSSVYQLNSKPTG
ADLLEEHLGEIRNLRQRLEESICINDRLREQLEHRLTSTARGRGSTSNFYSQGLESIPQLCNENRVLREDNRRLQAQLSH
VSREHSQETESLREALLSSRSHLQELEKELEHQKVERQQLLEDLREKQQEVLHFREERLSLQENDSRLQHKLVLLQQQCE
EKQQLFESLQSELQIYEALYGNSKKGLKAYSLDACHQIPLSSDLSHLVAEVRALRGQLEQSIQGNNCLRLQLQQQLESGA
GKASLSPSSINQNFPASTDPGNKQLLLQDSAVSPPVRDVGMNSPALVFPSSASSTPGSETPIINRANGLGLDTSPVMKTP
PKLEGDATDGSFANKHGRHVIGHIDDYSALRQQIAEGKLLVKKIVSLVRSACSFPGLEAQGTEVLGSKGIHELRSSTSAL
HHALEESASLLTMFWRAALPSTHIPVLPGKVGESTERELLELRTKVSKQERLLQSTTEHLKNANQQKESMEQFIVSQLTR
THDVLKKARTNLEVKSLRALPCTPAL