Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU25817 PLXNB2 KIAA0315 Homo sapiens No Membrane Proteins

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
21 61 10 JHU25817
21 62 10 JHU25817

External Database ID

Nucleotide (5514bp)

>JHU25817
ATGGCACTGCAGCTCTGGGCCCTGACCCTGCTGGGCCTGCTGGGCGCAGGTGCCAGCCTGAGGCCCCGCAAGCTGGACTT
CTTCCGCAGCGAGAAAGAGCTGAACCACCTGGCTGTGGATGAGGCCTCAGGCGTGGTGTACCTGGGGGCGGTGAATGCCC
TCTACCAGCTGGATGCGAAGCTGCAGCTGGAGCAGCAGGTGGCCACGGGCCCGGCCCTGGACAACAAGAAGTGCACGCCG
CCCATCGAGGCCAGCCAGTGCCATGAGGCTGAGATGACTGACAATGTCAACCAGCTGCTGCTGCTCGACCCTCCCAGGAA
GCGCCTGGTGGAGTGCGGCAGCCTCTTCAAGGGCATCTGCGCTCTGCGCGCCCTGAGCAACATCTCCCTCCGCCTGTTCT
ACGAGGACGGCAGCGGGGAGAAGTCTTTCGTGGCCAGCAATGATGAGGGCGTGGCCACAGTGGGGCTGGTGAGCTCCACG
GGTCCTGGTGGTGACCGCGTGCTGTTTGTGGGCAAAGGCAATGGGCCACACGACAACGGCATCATCGTGAGCACTCGGCT
GTTGGACCGGACTGACAGCAGGGAGGCCTTTGAAGCCTACACGGACCACGCCACCTACAAGGCCGGCTACCTGTCCACCA
ACACACAGCAGTTCGTGGCGGCCTTCGAGGACGGCCCCTACGTCTTCTTTGTCTTCAACCAGCAGGACAAGCACCCGGCC
CGGAACCGCACGCTGCTGGCACGCATGTGCAGAGAAGACCCCAACTACTACTCCTACCTGGAGATGGACCTGCAGTGCCG
GGACCCCGACATCCACGCCGCTGCCTTTGGCACCTGCCTGGCCGCCTCCGTGGCTGCGCCTGGCTCTGGCAGGGTGCTAT
ATGCTGTCTTCAGCAGAGACAGCCGGAGCAGTGGGGGGCCCGGTGCGGGCCTCTGCCTGTTCCCGCTGGACAAGGTGCAC
GCCAAGATGGAGGCCAACCGCAACGCCTGTTACACAGGCACCCGGGAGGCCCGTGACATCTTCTACAAGCCCTTCCACGG
CGATATCCAGTGCGGCGGCCACGCGCCGGGCTCCAGCAAGAGCTTCCCATGTGGCTCGGAGCACCTGCCCTACCCGCTGG
GCAGCCGCGACGGGCTCAGAGGCACAGCCGTGCTGCAGCGTGGAGGCCTGAACCTCACGGCCGTGACGGTCGCCGCCGAG
AACAACCACACTGTTGCTTTTCTGGGCACCTCTGATGGCCGGATCCTCAAGGTGTACCTCACCCCAGATGGCACCTCCTC
AGAGTACGACTCTATCCTTGTGGAGATAAACAAGAGAGTCAAGCGCGACCTGGTACTGTCTGGAGACCTGGGCAGCCTGT
ACGCCATGACCCAGGACAAGGTGTTCCGGCTGCCGGTGCAGGAGTGCCTGAGCTACCCGACCTGCACCCAGTGCCGCGAC
TCCCAGGACCCCTACTGCGGCTGGTGCGTCGTCGAGGGACGATGCACCCGGAAGGCCGAGTGTCCGCGGGCCGAGGAGGC
CAGCCACTGGCTGTGGAGCCGAAGCAAGTCCTGCGTGGCCGTCACCAGCGCCCAGCCACAGAACATGAGCCGGCGGGCCC
AGGGGGAGGTGCAGCTGACCGTCAGCCCCCTCCCTGCCCTGAGCGAGGAGGACGAGTTGCTGTGCCTTTTTGGGGAGTCG
CCGCCACACCCCGCCCGCGTGGAGGGCGAGGCCGTCATCTGCAACTCCCCAAGCAGCATCCCCGTCACACCGCCAGGCCA
GGACCACGTGGCCGTGACCATCCAGCTCCTCCTTAGACGAGGCAACATCTTCCTCACGTCCTACCAGTACCCCTTCTACG
ACTGCCGCCAGGCCATGAGCCTGGAGGAGAACCTGCCGTGCATCTCCTGCGTGAGCAACCGCTGGACCTGCCAGTGGGAC
CTGCGCTACCACGAGTGCCGGGAGGCTTCGCCCAACCCTGAGGACGGCATCGTCCGTGCCCACATGGAGGACAGCTGTCC
CCAGTTCCTGGGACCCAGCCCCCTGGTGATCCCCATGAACCACGAGACAGATGTGAACTTCCAGGGCAAGAACCTGGACA
CCGTGAAGGGTTCCTCCCTGCACGTGGGCAGTGACTTGCTCAAGTTCATGGAGCCGGTGACCATGCAGGAATCTGGGACC
TTCGCCTTTCGGACCCCAAAGCTGTCCCACGATGCCAACGAGACGCTGCCCCTGCACCTCTACGTCAAGTCTTACGGCAA
GAATATCGACAGCAAGCTCCATGTGACCCTCTACAACTGCTCCTTTGGCCGCAGCGACTGCAGCCTGTGCCGGGCCGCTA
ACCCCGACTACAGGTGTGCGTGGTGCGGGGGCCAGAGCAGGTGCGTGTATGAGGCCCTGTGCAACACCACCTCCGAGTGC
CCGCCGCCCGTCATCACCAGGATCCAGCCTGAGACGGGCCCCCTGGGTGGGGGCATCCGCATCACCATCCTGGGGTCCAA
TTTGGGCGTCCAAGCAGGGGACATCCAGAGGATCTCTGTGGCCGGCCGGAACTGCTCCTTTCAGCCGGAACGTTACTCCG
TGTCCACCCGGATCGTGTGTGTGATCGAGGCTGCGGAGACGCCTTTCACGGGGGGTGTCGAGGTGGACGTCTTCGGGAAA
CTGGGCCGTTCGCCTCCCAATGTCCAGTTCACCTTCCAACAGCCCAAGCCTCTCAGTGTGGAGCCGCAGCAGGGACCGCA
GGCGGGCGGCACCACACTGACCATCCACGGCACCCACCTGGACACGGGCTCCCAGGAGGACGTGCGGGTGACCCTCAACG
GCGTCCCGTGTAAAGTGACGAAGTTTGGGGCGCAGCTCCAGTGTGTCACTGGCCCCCAGGCGACACGGGGCCAGATGCTT
CTGGAGGTCTCCTACGGGGGGTCCCCCGTGCCCAACCCCGGCATCTTCTTCACCTACCGCGAAAACCCCGTACTGCGAGC
CTTCGAGCCGCTACGAAGCTTTGCCAGTGGTGGCCGCAGCATCAACGTCACGGGTCAGGGCTTCAGCCTGATCCAGAGGT
TTGCCATGGTGGTCATCGCGGAGCCCCTGCAGTCCTGGCAGCCGCCGCGGGAGGCTGAATCCCTGCAGCCCATGACGGTG
GTGGGTACAGACTACGTGTTCCACAATGACACCAAGGTCGTCTTCCTGTCCCCGGCTGTGCCTGAGGAGCCAGAGGCCTA
CAACCTCACGGTGCTGATCGAGATGGACGGGCACCGTGCCCTGCTCAGAACAGAGGCCGGGGCCTTCGAGTACGTGCCTG
ACCCCACCTTTGAGAACTTCACAGGTGGCGTCAAGAAGCAGGTCAACAAGCTCATCCACGCCCGGGGCACCAATCTGAAC
AAGGCGATGACGCTGCAGGAGGCCGAGGCCTTCGTGGGTGCCGAGCGCTGCACCATGAAGACGCTGACGGAGACCGACCT
GTACTGTGAGCCCCCGGAGGTGCAGCCCCCGCCCAAGCGGCGGCAGAAACGAGACACCACACACAACCTGCCCGAGTTCA
TTGTGAAGTTCGGCTCTCGCGAGTGGGTGCTGGGCCGCGTGGAGTACGACACACGGGTGAGCGACGTGCCGCTCAGCCTC
ATCTTGCCGCTGGTCATCGTGCCCATGGTGGTCGTCATCGCGGTGTCTGTCTACTGCTACTGGAGGAAGAGCCAGCAGGC
CGAACGAGAGTATGAGAAGATCAAGTCCCAGCTGGAGGGCCTGGAGGAGAGCGTGCGGGACCGCTGCAAGAAGGAATTCA
CAGACCTGATGATCGAGATGGAGGACCAGACCAACGACGTGCACGAGGCCGGCATCCCCGTGCTGGACTACAAGACCTAC
ACCGACCGCGTCTTCTTCCTGCCCTCCAAGGACGGCGACAAGGACGTGATGATCACCGGCAAGCTGGACATCCCTGAGCC
GCGGCGGCCGGTGGTGGAGCAGGCCCTCTACCAGTTCTCCAACCTGCTGAACAGCAAGTCTTTCCTCATCAATTTCATCC
ACACCCTGGAGAACCAGCGGGAGTTCTCGGCCCGCGCCAAGGTCTACTTCGCGTCCCTGCTGACGGTGGCGCTGCACGGG
AAACTGGAGTACTACACGGACATCATGCACACGCTCTTCCTGGAGCTCCTGGAGCAGTACGTGGTGGCCAAGAACCCCAA
GCTGATGCTGCGCAGGTCTGAGACTGTGGTGGAGAGGATGCTGTCCAACTGGATGTCCATCTGCCTGTACCAGTACCTCA
AGGACAGTGCCGGGGAGCCCCTGTACAAGCTCTTCAAGGCCATCAAACATCAGGTGGAAAAGGGCCCGGTGGATGCGGTA
CAGAAGAAGGCCAAGTACACTCTCAACGACACGGGGCTGCTGGGGGATGATGTGGAGTACGCACCCCTGACGGTGAGCGT
GATCGTGCAGGACGAGGGAGTGGACGCCATCCCGGTGAAGGTCCTCAACTGTGACACCATCTCCCAGGTCAAGGAGAAGA
TCATTGACCAGGTGTACCGTGGGCAGCCCTGCTCCTGCTGGCCCAGGCCAGACAGCGTGGTCCTGGAGTGGCGTCCGGGC
TCCACAGCGCAGATCCTGTCGGACCTGGACCTGACGTCACAGCGGGAGGGCCGGTGGAAGCGCGTCAACACCCTTATGCA
CTACAATGTCCGGGATGGAGCCACCCTCATCCTGTCCAAGGTGGGGGTCTCCCAGCAGCCGGAGGACAGCCAGCAGGACC
TGCCTGGGGAGCGCCATGCCCTCCTGGAGGAGGAGAACCGGGTGTGGCACCTGGTGCGGCCGACCGACGAGGTGGACGAG
GGCAAGTCCAAGAGAGGCAGCGTGAAAGAGAAGGAGCGGACGAAGGCCATCACCGAGATCTACCTGACGCGGCTGCTCTC
AGTCAAGGGCACACTGCAGCAGTTTGTGGACAACTTCTTCCAGAGCGTGCTGGCGCCTGGGCACGCGGTGCCACCTGCAG
TCAAGTACTTCTTCGACTTCCTGGACGAGCAGGCAGAGAAGCACAACATCCAGGATGAAGACACCATCCACATCTGGAAG
ACGAACAGCTTACCGCTCCGGTTCTGGGTGAACATCCTCAAGAACCCCCACTTCATCTTTGACGTGCATGTCCACGAGGT
GGTGGACGCCTCGCTGTCAGTCATCGCGCAGACCTTCATGGATGCCTGCACGCGCACGGAGCATAAGCTGAGCCGCGATT
CTCCCAGCAACAAGCTGCTGTACGCCAAGGAGATCTCCACCTACAAGAAGATGGTGGAGGATTACTACAAGGGGATCCGG
CAGATGGTGCAGGTCAGCGACCAGGACATGAACACACACCTGGCAGAGATTTCCCGGGCGCACACGGACTCCTTGAACAC
CCTCGTGGCACTCCACCAGCTCTACCAATACACGCAGAAGTACTATGACGAGATCATCAATGCCTTGGAGGAGGATCCTG
CCGCCCAGAAGATGCAGCTGGCCTTCCGCCTGCAGCAGATTGCCGCTGCACTGGAGAACAAGGTCACTGACCTC

Protein (1838aa)

>JHU25817
MALQLWALTLLGLLGAGASLRPRKLDFFRSEKELNHLAVDEASGVVYLGAVNALYQLDAKLQLEQQVATGPALDNKKCTP
PIEASQCHEAEMTDNVNQLLLLDPPRKRLVECGSLFKGICALRALSNISLRLFYEDGSGEKSFVASNDEGVATVGLVSST
GPGGDRVLFVGKGNGPHDNGIIVSTRLLDRTDSREAFEAYTDHATYKAGYLSTNTQQFVAAFEDGPYVFFVFNQQDKHPA
RNRTLLARMCREDPNYYSYLEMDLQCRDPDIHAAAFGTCLAASVAAPGSGRVLYAVFSRDSRSSGGPGAGLCLFPLDKVH
AKMEANRNACYTGTREARDIFYKPFHGDIQCGGHAPGSSKSFPCGSEHLPYPLGSRDGLRGTAVLQRGGLNLTAVTVAAE
NNHTVAFLGTSDGRILKVYLTPDGTSSEYDSILVEINKRVKRDLVLSGDLGSLYAMTQDKVFRLPVQECLSYPTCTQCRD
SQDPYCGWCVVEGRCTRKAECPRAEEASHWLWSRSKSCVAVTSAQPQNMSRRAQGEVQLTVSPLPALSEEDELLCLFGES
PPHPARVEGEAVICNSPSSIPVTPPGQDHVAVTIQLLLRRGNIFLTSYQYPFYDCRQAMSLEENLPCISCVSNRWTCQWD
LRYHECREASPNPEDGIVRAHMEDSCPQFLGPSPLVIPMNHETDVNFQGKNLDTVKGSSLHVGSDLLKFMEPVTMQESGT
FAFRTPKLSHDANETLPLHLYVKSYGKNIDSKLHVTLYNCSFGRSDCSLCRAANPDYRCAWCGGQSRCVYEALCNTTSEC
PPPVITRIQPETGPLGGGIRITILGSNLGVQAGDIQRISVAGRNCSFQPERYSVSTRIVCVIEAAETPFTGGVEVDVFGK
LGRSPPNVQFTFQQPKPLSVEPQQGPQAGGTTLTIHGTHLDTGSQEDVRVTLNGVPCKVTKFGAQLQCVTGPQATRGQML
LEVSYGGSPVPNPGIFFTYRENPVLRAFEPLRSFASGGRSINVTGQGFSLIQRFAMVVIAEPLQSWQPPREAESLQPMTV
VGTDYVFHNDTKVVFLSPAVPEEPEAYNLTVLIEMDGHRALLRTEAGAFEYVPDPTFENFTGGVKKQVNKLIHARGTNLN
KAMTLQEAEAFVGAERCTMKTLTETDLYCEPPEVQPPPKRRQKRDTTHNLPEFIVKFGSREWVLGRVEYDTRVSDVPLSL
ILPLVIVPMVVVIAVSVYCYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMIEMEDQTNDVHEAGIPVLDYKTY
TDRVFFLPSKDGDKDVMITGKLDIPEPRRPVVEQALYQFSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHG
KLEYYTDIMHTLFLELLEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDSAGEPLYKLFKAIKHQVEKGPVDAV
QKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDAIPVKVLNCDTISQVKEKIIDQVYRGQPCSCWPRPDSVVLEWRPG
STAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILSKVGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDE
GKSKRGSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLAPGHAVPPAVKYFFDFLDEQAEKHNIQDEDTIHIWK
TNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLLYAKEISTYKKMVEDYYKGIR
QMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVTDL