Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU25777 SLC34A3 NPT2C;NPTIIC Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
24 61 13 JHU25777
24 62 13 JHU25777

External Database ID

Nucleotide (1797bp)

>JHU25777
ATGCCGAGTTCCCTTCCCGGCAGCCAGGTCCCCCACCCCACTCTGGACGCGGTTGACCTAGTGGAAAAGACTCTGAGGAA
TGAAGGGACCTCCAGTTCTGCTCCAGTCTTGGAGGAAGGGGACACAGACCCCTGGACCCTCCCTCAGCTGAAGGACACAA
GCCAGCCCTGGAAAGAGCTCCGCGTGGCCGGCAGGCTGCGCCGCGTGGCCGGCAGCGTCCTCAAGGCCTGCGGGCTCCTC
GGCAGCCTGTACTTCTTCATCTGCTCTCTGGACGTCCTCAGCTCCGCCTTCCAGCTGCTGGGCAGCAAAGTGGCCGGAGA
CATCTTCAAGGACAACGTGGTGCTGTCCAACCCTGTGGCTGGACTGGTCATTGGCGTGCTGGTCACAGCCCTGGTGCAGA
GTTCCAGCACGTCCTCCTCCATCGTGGTCAGCATGGTGGCTGCTAAGCTGCTGACTGTCCGGGTGTCTGTGCCCATCATC
ATGGGTGTCAACGTAGGCACATCCATCACCAGCACCCTGGTCTCAATGGCGCAGTCAGGGGACCGGGATGAATTTCAGAG
GGCTTTCAGCGGCTCGGCGGTGCACGGGATCTTCAACTGGCTCACAGTGCTGGTCCTGCTGCCACTGGAGAGCGCCACGG
CCCTGCTGGAGAGGCTAAGTGAGCTAGCCCTGGGTGCCGCCAGCCTGACACCCAGGGCGCAGGCGCCCGACATCCTCAAG
GTGCTGACGAAGCCGCTCACACACCTCATCGTGCAGTTGGACTCCGACATGATCATGAGCAGTGCCACAGGCAACGCCAC
TAACAGCAGTCTCATTAAGCACTGGTGCGGCACCACGGGGCAGCCGACCCAGGAGAACAGCAGCTGTGGCGCCTTCGGCC
CGTGCACAGAGAAGAACAGCACAGCCCCGGCGGACAGGCTGCCCTGCCGCCACCTGTTTGCGGGCACGGAGCTCACGGAC
CTGGCCGTGGGCTGCATCCTGCTGGCCGGCTCCCTGCTGGTGCTCTGCGGCTGCCTGGTCCTCATAGTCAAGCTGCTCAA
CTCTGTGCTGCGCGGCCGCGTGGCCCAGGTCGTGAGGACAGTCATCAATGCGGACTTCCCCTTCCCGCTGGGCTGGCTCG
GCGGCTACCTGGCCGTCCTCGCGGGCGCCGGCCTGACCTTCGCACTGCAGAGCAGCAGCGTCTTCACGGCGGCCGTCGTG
CCCCTCATGGGGGTCGGGGTGATCAGTCTGGACCGGGCGTACCCCCTCTTACTGGGCTCCAACATCGGCACCACTACCAC
AGCCCTGCTGGCTGCCCTGGCCAGCCCCGCAGACAGGATGCTCAGCGCCCTGCAGGTCGCCCTCATCCACTTCTTCTTCA
ACCTGGCCGGCATCCTGCTGTGGTACCTGGTGCCTGCACTGCGGCTGCCCATCCCGCTGGCCAGGCACTTCGGGGTGGTG
ACCGCCCGTTACCGCTGGGTGGCTGGGGTCTACCTGCTGCTCGGATTCCTGCTGCTGCCCCTGGCGGCCTTCGGGCTCTC
CCTGGCAGGGGGCATGGTGCTGGCCGCTGTCGGGGGTCCCCTGGTGGGGCTGGTGCTCCTCGTCATCCTGGTTACTGTCC
TGCAGCGGCGCCGGCCGGCCTGGCTGCCTGTCCGCCTGCGCTCCTGGGCCTGGCTCCCCGTCTGGCTCCATTCTCTGGAG
CCCTGGGACCGCCTGGTGACCCGCTGCTGCCCCTGCAACGTCTGCAGCCCCCCGAAGGCCACCACCAAAGAGGCCTACTG
CTACGAGAACCCTGAGATCTTGGCCTCCCAGCAGTTG

Protein (599aa)

>JHU25777
MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKELRVAGRLRRVAGSVLKACGLL
GSLYFFICSLDVLSSAFQLLGSKVAGDIFKDNVVLSNPVAGLVIGVLVTALVQSSSTSSSIVVSMVAAKLLTVRVSVPII
MGVNVGTSITSTLVSMAQSGDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASLTPRAQAPDILK
VLTKPLTHLIVQLDSDMIMSSATGNATNSSLIKHWCGTTGQPTQENSSCGAFGPCTEKNSTAPADRLPCRHLFAGTELTD
LAVGCILLAGSLLVLCGCLVLIVKLLNSVLRGRVAQVVRTVINADFPFPLGWLGGYLAVLAGAGLTFALQSSSVFTAAVV
PLMGVGVISLDRAYPLLLGSNIGTTTTALLAALASPADRMLSALQVALIHFFFNLAGILLWYLVPALRLPIPLARHFGVV
TARYRWVAGVYLLLGFLLLPLAAFGLSLAGGMVLAAVGGPLVGLVLLVILVTVLQRRRPAWLPVRLRSWAWLPVWLHSLE
PWDRLVTRCCPCNVCSPPKATTKEAYCYENPEILASQQL