Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU25749 A2ML1 CPAMD9 Homo sapiens No Secreted Proteins

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
21 61 25 JHU25749
21 62 25 JHU25749

External Database ID

Nucleotide (4362bp)

>JHU25749
ATGTGGGCTCAGCTCCTTCTAGGAATGTTGGCCCTATCACCAGCCATTGCAGAAGAACTTCCAAACTACCTGGTGACATT
ACCAGCCCGGCTAAATTTCCCCTCCGTTCAGAAGGTTTGTTTGGACCTGAGCCCTGGGTACAGTGATGTTAAATTCACGG
TTACTCTGGAGACCAAGGACAAGACCCAGAAGTTGCTAGAATACTCTGGACTGAAGAAGAGGCACTTACATTGTATCTCC
TTTCTTGTACCACCTCCTGCTGGTGGCACAGAAGAAGTGGCCACAATCCGGGTGTCGGGAGTTGGAAATAACATCAGCTT
TGAGGAGAAGAAAAAGGTTCTAATTCAGAGGCAGGGGAACGGCACCTTTGTACAGACTGACAAACCTCTCTACACCCCAG
GGCAGCAAGTGTATTTCCGCATTGTCACCATGGATAGCAACTTCGTTCCAGTGAATGACAAGTACTCCATGGTGGAACTA
CAGGATCCAAATAGCAACAGGATTGCACAGTGGCTGGAAGTGGTACCTGAGCAAGGCATTGTAGACCTGTCCTTCCAACT
GGCACCAGAGGCAATGCTGGGCACCTACACTGTGGCAGTGGCTGAGGGCAAGACCTTTGGTACTTTCAGTGTGGAGGAAT
ATGTGCTGCCGAAGTTTAAGGTGGAAGTGGTGGAACCCAAGGAGTTATCAACGGTGCAGGAATCTTTCTTAGTAAAAATT
TGTTGTAGGTACACCTATGGAAAGCCCATGCTAGGGGCAGTGCAGGTATCTGTGTGTCAGAAGGCAAATACTTACTGGTA
TCGAGAGGTGGAACGGGAACAGCTTCCTGACAAATGCAGGAACCTCTCTGGACAGACTGACAAAACAGGATGTTTCTCAG
CACCTGTGGACATGGCCACCTTTGACCTCATTGGATATGCGTACAGCCATCAAATCAATATTGTGGCTACTGTTGTGGAG
GAAGGGACAGGTGTGGAGGCCAATGCCACTCAGAATATCTACATTTCTCCACAAATGGGATCAATGACCTTTGAAGACAC
CAGCAATTTTTACCATCCAAATTTCCCCTTCAGTGGGAAGATAAGAGTTAGGGGCCATGATGACTCCTTCCTCAAGAACC
ATCTAGTGTTTCTGGTGATTTATGGCACAAATGGAACCTTCAACCAGACCCTGGTTACTGATAACAATGGCCTAGCTCCC
TTTACCTTGGAGACATCCGGTTGGAATGGGACAGACGTTTCTCTGGAGGGAAAGTTTCAAATGGAAGACTTAGTATATAA
TCCGGAACAAGTGCCACGTTACTACCAAAATGCCTACCTGCACCTGCGACCCTTCTACAGCACAACCCGCAGCTTCCTTG
GCATCCACCGGCTAAACGGCCCCTTGAAATGTGGCCAGCCCCAGGAAGTGCTGGTGGATTATTACATCGACCCGGCCGAT
GCAAGCCCTGACCAAGAGATCAGCTTCTCCTACTATTTAATAGGGAAAGGAAGTTTGGTGATGGAGGGGCAGAAACACCT
GAACTCTAAGAAGAAAGGACTGAAAGCCTCCTTCTCTCTCTCACTGACCTTCACTTCGAGACTGGCCCCTGATCCTTCCC
TGGTGATCTATGCCATTTTTCCCAGTGGAGGTGTTGTAGCTGACAAAATTCAGTTCTCAGTCGAGATGTGCTTTGACAAT
CAGGTTTCCCTTGGCTTCTCCCCCTCCCAGCAGCTTCCAGGAGCAGAAGTGGAGCTGCAGCTGCAGGCAGCTCCCGGATC
CCTGTGTGCGCTCCGGGCGGTGGATGAGAGTGTCTTACTGCTTAGGCCAGACAGAGAGCTGAGCAACCGCTCTGTCTATG
GGATGTTTCCATTCTGGTATGGTCACTACCCCTATCAAGTGGCTGAGTATGATCAGTGTCCAGTGTCTGGCCCATGGGAC
TTTCCTCAGCCCCTCATTGACCCAATGCCCCAAGGGCATTCGAGCCAGCGTTCCATTATCTGGAGGCCCTCGTTCTCTGA
AGGCACGGACCTTTTCAGCTTTTTCCGGGACGTGGGCCTGAAAATACTGTCCAATGCCAAAATCAAGAAGCCAGTAGATT
GCAGTCACAGATCTCCAGAATACAGCACTGCTATGGGTGCAGGCGGTGGTCATCCAGAGGCTTTTGAGTCATCAACTCCT
TTACATCAAGCAGAGGATTCTCAGGTCCGCCAGTACTTCCCAGAGACCTGGCTCTGGGATCTGTTTCCTATTGGTAACTC
GGGGAAGGAGGCGGTCCACGTCACAGTTCCTGACGCCATCACCGAGTGGAAGGCGATGAGTTTCTGCACTTCCCAGTCAA
GAGGCTTCGGGCTTTCACCCACTGTTGGACTAACTGCTTTCAAGCCGTTCTTTGTTGACCTGACTCTCCCTTACTCAGTA
GTCCGTGGGGAATCCTTTCGTCTTACTGCCACCATCTTCAATTACCTAAAGGATTGCATCAGGGTTCAGACTGACCTGGC
TAAATCGCATGAGTACCAGCTAGAATCATGGGCAGATTCTCAGACCTCCAGTTGTCTCTGTGCTGATGAAGCAAAAACCC
ACCACTGGAACATCACAGCTGTCAAATTGGGTCACATTAACTTTACTATTAGTACAAAGATTCTGGACAGCAATGAACCA
TGTGGGGGCCAGAAGGGGTTTGTTCCCCAAAAGGGCCGAAGTGACACGCTCATCAAGCCAGTTCTCGTCAAACCTGAGGG
AGTCCTGGTGGAGAAGACACACAGCTCATTGCTGTGCCCAAAAGGAAAGGTGGCATCTGAATCTGTCTCCCTGGAGCTCC
CAGTGGACATTGTTCCTGACTCGACCAAGGCTTATGTTACGGTTCTGGGAGACATTATGGGCACAGCCCTGCAGAACCTG
GATGGTCTGGTGCAGATGCCCAGTGGCTGTGGCGAGCAGAACATGGTCTTGTTTGCTCCCATCATCTATGTCTTGCAGTA
CCTGGAGAAGGCAGGGCTGCTGACGGAGGAGATCAGGTCTCGGGCAGTGGGTTTCCTGGAAATAGGGTACCAGAAGGAGC
TGATGTACAAACACAGCAATGGCTCATACAGTGCCTTTGGGGAGCGAGATGGAAATGGAAACACATGGCTGACAGCGTTT
GTCACAAAATGCTTTGGCCAAGCTCAGAAATTCATCTTCATTGATCCCAAGAACATCCAGGATGCTCTCAAGTGGATGGC
AGGAAACCAGCTCCCCAGTGGCTGCTATGCCAACGTGGGAAATCTCCTTCACACAGCTATGAAGGGTGGTGTTGATGATG
AGGTCTCCTTGACTGCGTATGTCACAGCTGCATTGCTGGAGATGGGAAAGGATGTAGATGACCCAATGGTGAGTCAGGGT
CTACGGTGTCTCAAGAATTCGGCCACCTCCACGACCAACCTCTACACACAGGCCCTGTTGGCTTACATTTTCTCCCTGGC
TGGGGAAATGGACATCAGAAACATTCTCCTTAAACAGTTAGATCAACAGGCTATCATCTCAGGAGAATCCATTTACTGGA
GCCAGAAACCTACTCCATCATCGAACGCCAGCCCTTGGTCTGAGCCTGCGGCTGTAGATGTGGAACTCACAGCATATGCA
TTGTTGGCCCAGCTTACCAAGCCCAGCCTGACTCAAAAGGAGATAGCGAAGGCCACTAGCATAGTGGCTTGGTTGGCCAA
GCAACGCAATGCATATGGGGGCTTCTCTTCTACTCAGGATACTGTAGTTGCTCTCCAAGCTCTTGCCAAATATGCCACTA
CCGCCTACATGCCATCTGAGGAGATCAACCTGGTTGTAAAATCCACTGAGAATTTCCAGCGCACATTCAACATACAGTCA
GTTAACAGATTGGTATTTCAGCAGGATACCCTGCCCAATGTCCCTGGAATGTACACGTTGGAGGCCTCAGGCCAGGGCTG
TGTCTATGTGCAGACGGTGTTGAGATACAATATTCTCCCTCCCACAAATATGAAGACCTTTAGTCTTAGTGTGGAAATAG
GAAAAGCTAGATGTGAGCAACCGACTTCACCTCGATCCTTGACTCTCACTATTCACACCAGTTATGTGGGGAGCCGTAGC
TCTTCCAATATGGCTATTGTGGAAGTGAAGATGCTATCTGGGTTCAGTCCCATGGAGGGCACCAATCAGTTACTTCTCCA
GCAACCCCTGGTGAAGAAGGTTGAATTTGGAACTGACACACTTAACATTTACTTGGATGAGCTCATTAAGAACACTCAGA
CTTACACCTTCACCATCAGCCAAAGTGTGCTGGTCACCAACTTGAAACCAGCAACCATCAAGGTCTATGACTACTACCTA
CCAGATGAACAGGCAACAATTCAGTATTCTGATCCCTGTGAA

Protein (1454aa)

>JHU25749
MWAQLLLGMLALSPAIAEELPNYLVTLPARLNFPSVQKVCLDLSPGYSDVKFTVTLETKDKTQKLLEYSGLKKRHLHCIS
FLVPPPAGGTEEVATIRVSGVGNNISFEEKKKVLIQRQGNGTFVQTDKPLYTPGQQVYFRIVTMDSNFVPVNDKYSMVEL
QDPNSNRIAQWLEVVPEQGIVDLSFQLAPEAMLGTYTVAVAEGKTFGTFSVEEYVLPKFKVEVVEPKELSTVQESFLVKI
CCRYTYGKPMLGAVQVSVCQKANTYWYREVEREQLPDKCRNLSGQTDKTGCFSAPVDMATFDLIGYAYSHQINIVATVVE
EGTGVEANATQNIYISPQMGSMTFEDTSNFYHPNFPFSGKIRVRGHDDSFLKNHLVFLVIYGTNGTFNQTLVTDNNGLAP
FTLETSGWNGTDVSLEGKFQMEDLVYNPEQVPRYYQNAYLHLRPFYSTTRSFLGIHRLNGPLKCGQPQEVLVDYYIDPAD
ASPDQEISFSYYLIGKGSLVMEGQKHLNSKKKGLKASFSLSLTFTSRLAPDPSLVIYAIFPSGGVVADKIQFSVEMCFDN
QVSLGFSPSQQLPGAEVELQLQAAPGSLCALRAVDESVLLLRPDRELSNRSVYGMFPFWYGHYPYQVAEYDQCPVSGPWD
FPQPLIDPMPQGHSSQRSIIWRPSFSEGTDLFSFFRDVGLKILSNAKIKKPVDCSHRSPEYSTAMGAGGGHPEAFESSTP
LHQAEDSQVRQYFPETWLWDLFPIGNSGKEAVHVTVPDAITEWKAMSFCTSQSRGFGLSPTVGLTAFKPFFVDLTLPYSV
VRGESFRLTATIFNYLKDCIRVQTDLAKSHEYQLESWADSQTSSCLCADEAKTHHWNITAVKLGHINFTISTKILDSNEP
CGGQKGFVPQKGRSDTLIKPVLVKPEGVLVEKTHSSLLCPKGKVASESVSLELPVDIVPDSTKAYVTVLGDIMGTALQNL
DGLVQMPSGCGEQNMVLFAPIIYVLQYLEKAGLLTEEIRSRAVGFLEIGYQKELMYKHSNGSYSAFGERDGNGNTWLTAF
VTKCFGQAQKFIFIDPKNIQDALKWMAGNQLPSGCYANVGNLLHTAMKGGVDDEVSLTAYVTAALLEMGKDVDDPMVSQG
LRCLKNSATSTTNLYTQALLAYIFSLAGEMDIRNILLKQLDQQAIISGESIYWSQKPTPSSNASPWSEPAAVDVELTAYA
LLAQLTKPSLTQKEIAKATSIVAWLAKQRNAYGGFSSTQDTVVALQALAKYATTAYMPSEEINLVVKSTENFQRTFNIQS
VNRLVFQQDTLPNVPGMYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYVGSRS
SSNMAIVEVKMLSGFSPMEGTNQLLLQQPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYL
PDEQATIQYSDPCE