Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU25740 ZMIZ1 KIAA1224;RAI17;ZIMP10 Homo sapiens No Nuclear Proteins

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
23 61 10 JHU25740
23 62 10 JHU25740

External Database ID

Nucleotide (3201bp)

>JHU25740
ATGAATTCTATGGACAGGCACATCCAGCAGACCAATGACCGACTGCAGTGCATCAAGCAGCACTTACAGAATCCTGCCAA
CTTCCACAATGCCGCCACGGAGCTGCTGGACTGGTGCGGAGACCCACGGGCCTTCCAGCGGCCCTTCGAGCAGAGCCTGA
TGGGCTGTTTGACGGTGGTCAGTCGGGTGGCAGCCCAGCAAGGCTTTGACCTGGACCTCGGCTACAGACTGCTGGCTGTG
TGTGCTGCAAACCGAGACAAGTTCACCCCGAAGTCTGCCGCCTTGTTGTCCTCCTGGTGCGAAGAGCTCGGCCGCCTGCT
GCTGCTCCGACATCAGAAGAGCCGCCAGAGCGATCCCCCTGGGAAACTCCCCATGCAGCCCCCTCTCAGCTCCATGAGCT
CCATGAAACCCACTCTGTCGCACAGTGATGGGTCGTTCCCCTATGACTCTGTCCCTTGGCAGCAGAACACCAACCAGCCT
CCCGGCTCCCTTTCCGTGGTCACCACGGTTTGGGGAGTAACCAACACATCCCAGAGCCAGGTCCTTGGGAACCCTATGGC
CAATGCCAACAACCCCATGAATCCAGGCGGCAACCCCATGGCGTCGGGCATGACCACCAGCAACCCAGGCCTCAACTCCC
CACAGTTTGCGGGGCAGCAGCAGCAGTTCTCAGCCAAGGCTGGCCCCGCTCAGCCCTACATCCAGCAGAGCATGTATGGC
CGGCCCAACTACCCCGGCAGCGGGGGCTTTGGGGCCAGTTACCCTGGGGGTCCTAACGCCCCCGCAGGCATGGGCATCCC
TCCGCACACCAGGCCGCCTGCTGACTTCACTCAGCCCGCGGCAGCCGCTGCAGCAGCGGCAGTGGCAGCAGCAGCAGCCA
CAGCTACAGCCACAGCCACGGCCACTGTGGCAGCCCTGCAGGAGACACAGAACAAGGATATAAACCAGTATGGACCGATG
GGTCCCACCCAGGCGTATAACAGCCAATTCATGAACCAGCCCGGGCCGCGGGGGCCTGCCTCCATGGGGGGCAGCATGAA
CCCCGCGAGCATGGCGGCTGGCATGACGCCCTCGGGGATGAGCGGCCCTCCCATGGGCATGAACCAGCCCCGGCCGCCCG
GCATCAGCCCCTTTGGCACACACGGGCAGCGGATGCCCCAGCAGACCTACCCGGGCCCCCGGCCCCAGTCCCTTCCTATT
CAGAACATAAAGAGGCCATACCCTGGAGAGCCCAACTATGGAAACCAGCAATATGGACCAAACAGCCAGTTCCCCACCCA
GCCAGGCCAGTACCCAGCCCCCAACCCCCCGAGGCCACTCACCTCCCCCAACTACCCAGGACAGAGGATGCCCAGCCAGC
CGAGCTCCGGGCAGTACCCGCCCCCCACGGTCAACATGGGGCAGTATTACAAGCCAGAACAGTTTAATGGACAAAATAAC
ACGTTCTCGGGAAGCAGCTACAGTAACTACAGCCAAGGGAATGTCAACAGGCCTCCCAGGCCGGTTCCTGTGGCAAATTA
CCCCCACTCACCTGTTCCAGGGAACCCCACACCCCCCATGACCCCTGGGAGCAGCATCCCTCCATACCTGTCCCCCAGCC
AAGACGTCAAACCACCCTTCCCGCCTGACATCAAGCCAAATATGAGCGCTCTGCCACCACCCCCAGCCAACCACAATGAC
GAGCTGCGGCTCACATTCCCTGTGCGGGATGGCGTGGTGCTGGAGCCCTTCCGCCTGGAGCACAACCTGGCGGTCAGCAA
CCATGTGTTCCACCTGCGGCCCACGGTCCACCAGACGCTGATGTGGAGGTCTGACCTGGAGCTGCAGTTCAAGTGCTACC
ACCACGAGGACCGGCAGATGAACACCAACTGGCCCGCCTCGGTGCAGGTCAGCGTGAACGCCACGCCCCTCACCATTGAG
CGCGGCGACAACAAGACCTCCCACAAGCCCCTGCACCTGAAGCACGTGTGCCAGCCGGGCCGCAACACCATCCAGATCAC
CGTCACGGCCTGCTGCTGCTCCCACCTCTTCGTGCTGCAGCTGGTACACCGGCCCTCCGTCCGCTCTGTGCTGCAAGGAC
TCCTCAAGAAGCGCCTCCTGCCCGCAGAGCACTGTATCACGAAAATCAAGCGGAATTTCAGCAGCGTGGCTGCCTCCTCG
GGCAACACGACCCTCAACGGGGAGGATGGGGTGGAGCAGACGGCCATCAAGGTGTCTCTGAAGTGCCCCATCACATTCCG
GCGCATCCAGCTGCCTGCTCGAGGACACGATTGCAAGCATGTGCAGTGCTTTGATCTGGAGTCATACCTGCAGCTGAATT
GCGAGAGAGGGACCTGGAGGTGTCCTGTGTGCAATAAAACCGCTCTGCTGGAGGGCCTGGAGGTGGATCAGTACATGTGG
GGAATCCTGAATGCCATCCAACACTCCGAGTTTGAAGAGGTCACCATCGATCCCACGTGCAGCTGGCGGCCGGTGCCCAT
CAAGTCGGACTTACACATCAAGGACGACCCTGATGGCATCCCCTCCAAGCGGTTCAAGACCATGAGTCCCAGCCAGATGA
TCATGCCCAATGTCATGGAGATGATCGCAGCCCTGGGCCCCGGCCCGTCCCCCTATCCCCTCCCGCCTCCCCCAGGGGGC
ACCAACTCCAACGACTACAGCAGCCAAGGCAACAACTACCAAGGCCATGGCAACTTTGACTTCCCCCACGGGAACCCTGG
AGGGACATCCATGAATGACTTCATGCACGGGCCCCCCCAGCTCTCCCACCCCCCGGACATGCCCAACAACATGGCCGCCC
TCGAGAAACCCCTCAGCCACCCCATGCAGGAAACTATGCCACACGCTGGCAGCTCTGACCAGCCCCACCCCTCCATACAA
CAAGGTTTGCACGTACCACACCCCAGCAGCCAGTCAGGGCCTCCATTACATCACAGTGGGGCTCCTCCTCCTCCTCCTTC
CCAGCCTCCCCGGCAGCCGCCACAGGCCGCTCCCAGCAGCCATCCACACAGCGACCTGACCTTTAACCCCTCCTCAGCCT
TAGAGGGTCAGGCCGGAGCGCAGGGAGCGTCCGACATGCCGGAGCCTTCGCTGGATCTCCTTCCCGAACTCACAAATCCT
GACGAGCTCCTGTCTTATCTGGACCCCCCCGACCTGCCGAGCAATAGTAACGATGACCTCCTGTCTCTATTTGAGAACAA
C

Protein (1067aa)

>JHU25740
MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFEQSLMGCLTVVSRVAAQQGFDLDLGYRLLAV
CAANRDKFTPKSAALLSSWCEELGRLLLLRHQKSRQSDPPGKLPMQPPLSSMSSMKPTLSHSDGSFPYDSVPWQQNTNQP
PGSLSVVTTVWGVTNTSQSQVLGNPMANANNPMNPGGNPMASGMTTSNPGLNSPQFAGQQQQFSAKAGPAQPYIQQSMYG
RPNYPGSGGFGASYPGGPNAPAGMGIPPHTRPPADFTQPAAAAAAAAVAAAAATATATATATVAALQETQNKDINQYGPM
GPTQAYNSQFMNQPGPRGPASMGGSMNPASMAAGMTPSGMSGPPMGMNQPRPPGISPFGTHGQRMPQQTYPGPRPQSLPI
QNIKRPYPGEPNYGNQQYGPNSQFPTQPGQYPAPNPPRPLTSPNYPGQRMPSQPSSGQYPPPTVNMGQYYKPEQFNGQNN
TFSGSSYSNYSQGNVNRPPRPVPVANYPHSPVPGNPTPPMTPGSSIPPYLSPSQDVKPPFPPDIKPNMSALPPPPANHND
ELRLTFPVRDGVVLEPFRLEHNLAVSNHVFHLRPTVHQTLMWRSDLELQFKCYHHEDRQMNTNWPASVQVSVNATPLTIE
RGDNKTSHKPLHLKHVCQPGRNTIQITVTACCCSHLFVLQLVHRPSVRSVLQGLLKKRLLPAEHCITKIKRNFSSVAASS
GNTTLNGEDGVEQTAIKVSLKCPITFRRIQLPARGHDCKHVQCFDLESYLQLNCERGTWRCPVCNKTALLEGLEVDQYMW
GILNAIQHSEFEEVTIDPTCSWRPVPIKSDLHIKDDPDGIPSKRFKTMSPSQMIMPNVMEMIAALGPGPSPYPLPPPPGG
TNSNDYSSQGNNYQGHGNFDFPHGNPGGTSMNDFMHGPPQLSHPPDMPNNMAALEKPLSHPMQETMPHAGSSDQPHPSIQ
QGLHVPHPSSQSGPPLHHSGAPPPPPSQPPRQPPQAAPSSHPHSDLTFNPSSALEGQAGAQGASDMPEPSLDLLPELTNP
DELLSYLDPPDLPSNSNDDLLSLFENN