Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU25735 AKAP13 BRX;HT31;LBC Homo sapiens No Cell Death; Kinases; Nuclear Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
22 61 28 JHU25735
22 62 28 JHU25735

External Database ID

Nucleotide (8451bp)

>JHU25735
ATGAAACTTAATCCACAGCAAGCTCCCTTATATGGTGATTGTGTTGTTACAGTGCTGCTTGCTGAAGAGGACAAAGCTGA
AGATGATGTAGTGTTTTACTTGGTATTTTTGGGTTCCACCCTCCGTCACTGTACAAGTACTCGGAAGGTCAGTTCTGATA
CATTGGAGACCATTGCTCCTGGTCATGATTGTTGTGAAACAGTGAAGGTGCAGCTCTGTGCTTCCAAAGAGGGCCTTCCC
GTGTTTGTGGTGGCTGAAGAAGACTTTCATTTCGTCCAGGATGAAGCGTATGATGCAGCTCAATTCCTAGCAACCAGTGC
TGGAAATCAGCAGGCTTTGAACTTTACCCGTTTTCTTGACCAGTCAGGACCCCCATCTGGGGATGTGAATTCCCTTGATA
AGAAGTTGGTGCTGGCATTCAGGCACCTGAAGCTGCCCACGGAGTGGAATGTATTGGGGACAGATCAGAGTTTGCATGAT
GCTGGCCCGCGAGAGACATTGATGCATTTTGCTGTGCGGCTGGGACTGCTGAGGTTGACGTGGTTCCTGTTGCAGAAGCC
AGGTGGCCGCGGAGCTCTCAGTATCCACAACCAGGAAGGGGCGACGCCTGTGAGCTTGGCCTTGGAGCGAGGCTATCACA
AGCTGCACCAGCTTCTAACCGAGGAGAATGCTGGAGAACCAGACTCCTGGAGCAGTTTATCCTATGAAATACCGTATGGA
GACTGTTCTGTGAGGCATCATCGAGAGTTGGACATCTATACATTAACCTCTGAGTCTGATTCACATCATGAACACCCATT
TCCTGGAGACGGTTGCACTGGACCAATTTTTAAACTTATGAACATCCAACAGCAACTAATGAAAACAAACCTCAAGCAGA
TGGACAGTCTTATGCCCTTAATGATGACAGCACAGGATCCTTCCAGTGCCCCAGAGACAGATGGCCAGTTTCTTCCCTGT
GCACCGGAGCCCACGGACCCTCAGCGACTTTCTTCTTCTGAAGAGACTGAGAGCACTCAGTGCTGCCCAGGGAGCCCTGT
TGCACAGACTGAAAGTCCCTGTGATTTGTCAAGCATAGTTGAGGAGGAGAATACAGACCGTTCCTGTAGGAAGAAAAATA
AAGGCGTGGAAAGAAAAGGGGAAGAGGTGGAGCCAGCACCTATTGTGGACTCTGGAACTGTATCTGATCAAGACAGCTGC
CTTCAGAGCTTGCCTGATTGTGGAGTAAAGGGCACGGAAGGCCTTTCGTCCTGTGGAAACAGAAATGAAGAAACTGGAAC
AAAATCTTCTGGAATGCCCACAGACCAGGAGTCCCTGAGCAGTGGAGATGCTGTGCTTCAGAGAGACTTGGTCATGGAGC
CAGGCACAGCCCAGTATTCCTCTGGAGGTGAACTGGGAGGCATTTCAACAACAAATGTCAGTACCCCAGACACTGCAGGG
GAAATGGAACATGGGCTCATGAACCCAGATGCCACTGTTTGGAAGAATGTGCTTCAGGGAGGGGAAAGTACAAAGGAAAG
ATTTGAGAACTCTAATATTGGCACAGCTGGAGCCTCTGACGTGCACGTCACAAGTAAGCCTGTGGATAAAATCAGTGTTC
CAAACTGTGCCCCTGCTGCCAGTTCCCTGGATGGTAACAAACCTGCTGAGTCTTCACTTGCATTTAGTAATGAAGAAACC
TCCACTGAAAAAACAGCAGAAACGGAAACTTCACGAAGTCGTGAGGAGAGTGCTGATGCTCCAGTAGATCAGAATTCTGT
GGTGATTCCAGCTGCTGCAAAAGACAAGATTTCAGATGGATTAGAACCTTATACTCTCTTAGCAGCAGGCATAGGTGAGG
CAATGTCACCCTCAGATTTAGCCCTTCTTGGGCTGGAAGAAGATGTAATGCCACACCAGAACTCAGAAACAAATTCATCT
CATGCTCAAAGCCAAAAGGGCAAATCCTCACCCATTTGTTCTACAACTGGAGACGATAAACTTTGTGCAGACTCTGCATG
TCAACAGAACACAGTGACTTCTAGTGGCGATTTGGTTGCAAAACTGTGTGATAACATAGTTAGCGAGTCCGAAAGCACCA
CAGCAAGGCAACCCAGCTCACAAGATCCACCCGATGCCTCCCACTGTGAAGACCCACAGGCTCATACAGTCACCTCTGAC
CCTGTAAGGGATACCCAGGAACGTGCGGATTTTTGTCCTTTCAAAGTGGTGGATAACAAAGGCCAACGAAAAGATGTGAA
ACTAGATAAACCTTTAACAAATATGCTTGAGGTGGTTTCACATCCACATCCAGTTGTCCCTAAAATGGAGAAAGAACTGG
TGCCAGACCAGGCAGTAATATCAGACAGTACTTTCTCTCTGGCAAACAGTCCAGGCAGTGAATCAGTAACCAAGGATGAC
GCACTTTCTTTTGTCCCCTCCCAGAAAGAAAAGGGAACAGCAACTCCTGAACTACATACAGCTACAGATTATAGAGATGG
CCCAGATGGAAATTCGAATGAGCCTGATACGCGGCCACTAGAAGACAGGGCAGTAGGCCTGTCCACATCCTCCACTGCTG
CAGAGCTTCAGCACGGGATGGGGAATACCAGTCTCACAGGACTTGGTGGAGAGCATGAGGGTCCCGCCCCTCCAGCAATC
CCAGAAGCTCTGAATATCAAGGGGAACACTGACTCTTCCCTGCAAAGTGTGGGTAAGGCCACTTTGGCTTTAGATTCAGT
TTTGACTGAAGAAGGAAAACTTCTGGTGGTTTCAGAAAGCTCTGCAGCTCAGGAACAAGATAAGGATAAAGCGGTGACCT
GTTCCTCTATTAAGGAAAATGCTCTCTCTTCAGGAACTTTGCAGGAAGAGCAGAGAACACCACCTCCTGGACAAGATACT
CAACAATTTCATGAAAAATCAATCTCAGCTGACTGTGCCAAGGACAAAGCACTTCAGCTAAGTAATTCACCGGGTGCATC
CTCTGCCTTTCTTAAGGCAGAAACTGAACATAACAAGGAAGTGGCCCCACAAGTCTCACTGCTGACTCAAGGTGGGGCTG
CCCAGAGCCTGGTGCCACCAGGAGCAAGTCTGGCCACAGAGTCAAGGCAGGAAGCCTTGGGGGCAGAGCACAACAGCTCC
GCTCTGTTGCCATGTCTGTTGCCAGATGGGTCTGATGGGTCCGATGCTCTTAACTGCAGTCAGCCTTCTCCTCTGGATGT
TGGAGTGAAGAACACTCAATCCCAGGGAAAAACTAGTGCCTGTGAGGTGAGTGGAGATGTGACGGTGGATGTTACAGGGG
TTAATGCTCTACAAGGTATGGCTGAGCCCAGAAGAGAGAATATATCACACAACACCCAAGACATCCTGATTCCAAACGTC
TTGTTGAGCCAAGAGAAGAATGCCGTTCTAGGTTTGCCAGTGGCTCTACAGGACAAAGCTGTGACTGACCCACAGGGAGT
TGGAACCCCAGAGATGATACCTCTTGATTGGGAGAAAGGGAAGCTGGAGGGAGCAGACCACAGCTGTACCATGGGTGACG
CTGAGGAAGCCCAAATAGACGATGAAGCACATCCTGTCCTACTGCAGCCTGTTGCCAAGGAGCTCCCCACAGACATGGAG
CTCTCAGCCCATGATGATGGGGCCCCAGCTGGTGTGAGGGAAGTCATGCGAGCCCCGCCTTCAGGCAGGGAAAGGAGCAC
TCCCTCTCTACCTTGCATGGTCTCTGCCCAGGACGCACCTCTGCCTAAGGGGGCAGACTTGATAGAGGAGGCTGCCAGCC
GTATAGTGGATGCTGTCATCGAACAAGTCAAGGCCGCTGGAGCACTGCTTACTGAGGGGGAGGCCTGTCACATGTCACTG
TCCAGCCCTGAGTTGGGTCCTCTCACTAAAGGACTAGAGAGTGCTTTTACAGAAAAAGTGAGTACTTTCCCACCTGGGGA
GAGCCTACCAATGGGCAGTACTCCTGAGGAAGCCACGGGGAGCCTTGCAGGATGTTTTGCTGGAAGGGAGGAGCCAGAGA
AGATCATTTTACCTGTCCAGGGGCCTGAGCCAGCAGCAGAAATGCCAGACGTGAAAGCTGAAGATGAAGTGGATTTTAGA
GCAAGTTCAATTTCTGAAGAAGTGGCTGTAGGGAGCATAGCTGCTACACTGAAGATGAAGCAAGGCCCAATGACCCAGGC
GATAAACCGAGAAAACTGGTGTACAATAGAGCCATGCCCTGATGCAGCATCTCTTCTGGCTTCCAAGCAGAGCCCAGAAT
GTGAGAACTTCCTGGATGTTGGACTGGGCAGAGAGTGTACCTCAAAACAAGGTGTACTTAAAAGAGAATCTGGGAGTGAT
TCTGACCTCTTTCACTCACCCAGTGATGACATGGACAGCATCATCTTCCCAAAGCCAGAGGAAGAGCATTTGGCCTGTGA
TATCACCGGATCCAGTTCATCCACCGATGACACGGCTTCACTGGACCGACATTCTTCTCATGGCAGTGATGTGTCTCTCT
CCCAGATTTTAAAGCCAAACAGGTCAAGAGATCGGCAAAGCCTTGATGGATTCTACAGCCATGGGATGGGAGCTGAGGGT
CGAGAAAGTGAGAGTGAGCCTGCTGACCCAGGCGACGTGGAGGAGGAGGAGATGGACAGTATCACTGAAGTGCCTGCAAA
CTGCTCTGTCCTAAGGAGCTCCATGCGCTCTCTTTCTCCCTTCCGGAGGCACAGCTGGGGGCCTGGGAAAAATGCAGCCA
GCGATGCAGAAATGAACCACCGGAGTATGAGCTGGTGCCCCTCTGGTGTGCAGTACTCTGCTGGCCTGAGTGCTGACTTT
AATTACAGAAGTTTCAGTCTAGAAGGCTTGACAGGAGGAGCTGGTGTCGGAAACAAGCCATCCTCATCTCTAGAAGTAAG
CTCTGCAAATGCCGAAGAGCTCAGACACCCATTCAGTGGTGAGGAACGGGTTGACTCTTTGGTGTCACTTTCAGAAGAGG
ATCTGGAGTCAGACCAGAGAGAACATAGGATGTTTGATCAGCAGATATGTCACAGATCTAAGCAGCAGGGATTTAATTAC
TGTACATCAGCCATTTCCTCTCCATTGACAAAATCCATCTCATTAATGACAATCAGCCATCCTGGATTGGACAATTCACG
GCCCTTCCACAGTACCTTCCACAATACCAGTGCTAATCTGACTGAGAGTATAACAGAAGAGAACTATAATTTCCTGCCAC
ATAGCCCCTCCAAGAAAGATTCTGAATGGAAGAGTGGAACAAAAGTCAGTCGTACATTCAGCTACATCAAGAATAAAATG
TCTAGCAGCAAGAAGAGCAAAGAAAAGGAAAAAGAAAAAGATAAGATTAAGGAGAAGGAGAAAGATTCTAAAGACAAGGA
GAAAGATAAGAAGACTGTCAACGGGCACACTTTCAGTTCCATTCCTGTTGTGGGTCCCATCAGCTGTAGCCAGTGTATGA
AGCCCTTCACCAACAAAGATGCCTATACTTGTGCAAATTGCAGTGCTTTTGTCCACAAAGGCTGCCGAGAAAGTCTAGCC
TCCTGTGCAAAGGTCAAAATGAAGCAGCCCAAAGGGAGCCTTCAGGCACATGACACATCATCACTGCCCACGGTCATTAT
GAGAAACAAGCCCTCACAGCCCAAGGAGCGTCCTCGGTCCGCAGTCCTCCTGGTGGATGAAACCGCTACCACCCCAATAT
TTGCCAATAGACGATCCCAGCAGAGTGTCTCGCTCTCCAAAAGTGTCTCCATACAGAACATTACTGGAGTTGGCAATGAT
GAGAACATGTCAAACACCTGGAAATTCCTGTCTCATTCAACAGACTCACTAAATAAAATCAGCAAGGTCAATGAGTCAAC
AGAATCACTTACTGATGAGGGAGTAGGTACAGACATGAATGAAGGACAACTACTGGGAGACTTTGAGATTGAGTCCAAAC
AGCTGGAAGCAGAGTCTTGGAGTCGGATAATAGACAGCAAGTTTCTAAAACAGCAAAAGAAAGATGTGGTCAAACGGCAA
GAAGTAATATATGAGTTGATGCAGACAGAGTTTCATCATGTCCGCACTCTCAAGATCATGAGTGGTGTGTACAGCCAGGG
GATGATGGCGGATCTGCTTTTTGAGCAGCAGATGGTAGAAAAGCTGTTCCCCTGTTTGGATGAGCTGATCAGTATCCATA
GCCAATTCTTCCAGAGGATTCTGGAGCGGAAGAAGGAGTCTCTGGTGGATAAAAGTGAAAAGAACTTTCTCATCAAGAGG
ATAGGGGATGTGCTTGTAAATCAGTTTTCAGGTGAGAATGCAGAACGTTTAAAGAAGACATATGGCAAGTTTTGTGGGCA
ACATAACCAGTCTGTAAACTACTTCAAAGACCTTTATGCCAAGGATAAGCGTTTTCAAGCCTTTGTAAAGAAGAAGATGA
GCAGTTCAGTTGTTAGAAGGCTTGGAATTCCAGAGTGCATATTGCTTGTAACTCAGCGGATTACCAAGTACCCAGTTTTA
TTCCAAAGAATATTGCAGTGTACCAAAGACAATGAAGTGGAGCAGGAAGATCTAGCACAGTCCTTGAGCCTGGTGAAGGA
TGTGATTGGAGCTGTAGACAGCAAAGTGGCAAGTTATGAAAAGAAAGTGCGTCTCAATGAGATTTATACAAAGACAGATA
GCAAGTCAATCATGAGGATGAAGAGTGGTCAGATGTTTGCCAAGGAAGATTTGAAACGGAAGAAGCTTGTACGTGATGGG
AGTGTGTTTCTGAAGAATGCAGCAGGAAGGTTGAAAGAGGTTCAAGCAGTTCTTCTCACTGACATTTTAGTTTTCCTTCA
AGAAAAAGACCAGAAGTACATCTTTGCATCATTGGACCAGAAGTCAACAGTGATCTCTTTAAAGAAGCTGATTGTGAGAG
AAGTGGCACATGAGGAGAAAGGTTTATTCCTGATCAGCATGGGGATGACAGATCCAGAGATGGTAGAAGTCCATGCCAGC
TCCAAAGAGGAACGAAACAGCTGGATTCAGATCATTCAGGACACAATCAACACCCTGAACAGAGATGAAGATGAAGGAAT
TCCTAGTGAGAATGAGGAAGAAAAGAAAATGTTGGACACCAGAGCCCGAGAATTAAAAGAACAACTTCACCAGAAGGACC
AAAAAATCCTACTCTTGTTGGAAGAGAAGGAGATGATTTTCCGGGACATGGCTGAGTGCAGCACCCCTCTCCCAGAGGAT
TGCTCCCCAACACATAGCCCTAGAGTTCTCTTCCGCTCCAACACAGAAGAGGCTCTCAAAGGAGGACCTTTAATGAAAAG
TGCAATAAATGAGGTGGAGATCCTTCAGGGTTTGGTGAGTGGAAATCTGGGAGGCACACTTGGGCCGACTGTCAGCAGCC
CCATTGAGCAAGATGTGGTCGGTCCCGTTTCCCTGCCCCGGAGAGCAGAGACCTTTGGAGGATTTGACAGCCATCAGATG
AATGCTTCAAAAGGAGGCGAGAAGGAAGAGGGAGATGATGGCCAAGATCTTAGGAGAACGGAATCAGATAGTGGCCTAAA
AAAGGGTGGAAATGCTAACCTGGTATTTATGCTTAAAAGAAACAGTGAGCAGGTTGTCCAGAGCGTTGTTCATCTCTACG
AGCTCCTCAGCGCTCTGCAGGGTGTGGTGCTGCAGCAGGACAGCTACATTGAGGACCAGAAACTGGTGCTGAGCGAGAGG
GCGCTCACTCGCAGCTTGTCCCGCCCGAGCTCCCTCATTGAGCAGGAGAAGCAGCGCAGCCTGGAGAAGCAGCGCCAGGA
CCTGGCCAACCTGCAGAAGCAGCAGGCCCAGTACCTCGAGGAGAAGCGCAGGCGCGAGCGTGAGTGGGAAGCTCGTGAGA
GGGAGCTGCGGGAGCGGGAGGCCCTCCTGGCCCAGCGCGAGGAGGAGGTGCAGCAGGGGCAGCAGGACCTGGAAAAGGAG
CGGGAGGAGCTCCAGCAGAAGAAGGGCACATACCAGTATGACCTGGAGCGACTGCGTGCTGCCCAGAAACAGCTTGAGAG
GGAACAGGAGCAGCTGCGCCGGGAGGCAGAGCGGCTCAGCCAGCGGCAGACAGAACGGGACCTGTGTCAGGTTTCCCATC
CACATACCAAGCTGATGAGGATCCCATCGTTCTTCCCCAGTCCTGAGGAGCCCCCCTCGCCATCTGCACCTTCCATAGCC
AAATCAGGGTCATTGGACTCAGAACTTTCAGTGTCCCCAAAAAGGAACAGCATCTCTCGGACACACAAAGATAAGGGGCC
TTTTCACATACTGAGTTCAACCAGCCAGACAAACAAAGGACCAGAAGGGCAGAGCCAGGCCCCTGCGTCCACCTCTGCCT
CTACCCGCCTGTTTGGGTTAACAAAGCCAAAGGAAAAGAAGGAGAAAAAAAAGAAGAACAAAACCAGCCGCTCTCAGCCC
GGTGATGGTCCCGCGTCAGAAGTATCAGCAGAGGGTGAAGAGATCTTCTGC

Protein (2817aa)

>JHU25735
MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKVQLCASKEGLP
VFVVAEEDFHFVQDEAYDAAQFLATSAGNQQALNFTRFLDQSGPPSGDVNSLDKKLVLAFRHLKLPTEWNVLGTDQSLHD
AGPRETLMHFAVRLGLLRLTWFLLQKPGGRGALSIHNQEGATPVSLALERGYHKLHQLLTEENAGEPDSWSSLSYEIPYG
DCSVRHHRELDIYTLTSESDSHHEHPFPGDGCTGPIFKLMNIQQQLMKTNLKQMDSLMPLMMTAQDPSSAPETDGQFLPC
APEPTDPQRLSSSEETESTQCCPGSPVAQTESPCDLSSIVEEENTDRSCRKKNKGVERKGEEVEPAPIVDSGTVSDQDSC
LQSLPDCGVKGTEGLSSCGNRNEETGTKSSGMPTDQESLSSGDAVLQRDLVMEPGTAQYSSGGELGGISTTNVSTPDTAG
EMEHGLMNPDATVWKNVLQGGESTKERFENSNIGTAGASDVHVTSKPVDKISVPNCAPAASSLDGNKPAESSLAFSNEET
STEKTAETETSRSREESADAPVDQNSVVIPAAAKDKISDGLEPYTLLAAGIGEAMSPSDLALLGLEEDVMPHQNSETNSS
HAQSQKGKSSPICSTTGDDKLCADSACQQNTVTSSGDLVAKLCDNIVSESESTTARQPSSQDPPDASHCEDPQAHTVTSD
PVRDTQERADFCPFKVVDNKGQRKDVKLDKPLTNMLEVVSHPHPVVPKMEKELVPDQAVISDSTFSLANSPGSESVTKDD
ALSFVPSQKEKGTATPELHTATDYRDGPDGNSNEPDTRPLEDRAVGLSTSSTAAELQHGMGNTSLTGLGGEHEGPAPPAI
PEALNIKGNTDSSLQSVGKATLALDSVLTEEGKLLVVSESSAAQEQDKDKAVTCSSIKENALSSGTLQEEQRTPPPGQDT
QQFHEKSISADCAKDKALQLSNSPGASSAFLKAETEHNKEVAPQVSLLTQGGAAQSLVPPGASLATESRQEALGAEHNSS
ALLPCLLPDGSDGSDALNCSQPSPLDVGVKNTQSQGKTSACEVSGDVTVDVTGVNALQGMAEPRRENISHNTQDILIPNV
LLSQEKNAVLGLPVALQDKAVTDPQGVGTPEMIPLDWEKGKLEGADHSCTMGDAEEAQIDDEAHPVLLQPVAKELPTDME
LSAHDDGAPAGVREVMRAPPSGRERSTPSLPCMVSAQDAPLPKGADLIEEAASRIVDAVIEQVKAAGALLTEGEACHMSL
SSPELGPLTKGLESAFTEKVSTFPPGESLPMGSTPEEATGSLAGCFAGREEPEKIILPVQGPEPAAEMPDVKAEDEVDFR
ASSISEEVAVGSIAATLKMKQGPMTQAINRENWCTIEPCPDAASLLASKQSPECENFLDVGLGRECTSKQGVLKRESGSD
SDLFHSPSDDMDSIIFPKPEEEHLACDITGSSSSTDDTASLDRHSSHGSDVSLSQILKPNRSRDRQSLDGFYSHGMGAEG
RESESEPADPGDVEEEEMDSITEVPANCSVLRSSMRSLSPFRRHSWGPGKNAASDAEMNHRSMSWCPSGVQYSAGLSADF
NYRSFSLEGLTGGAGVGNKPSSSLEVSSANAEELRHPFSGEERVDSLVSLSEEDLESDQREHRMFDQQICHRSKQQGFNY
CTSAISSPLTKSISLMTISHPGLDNSRPFHSTFHNTSANLTESITEENYNFLPHSPSKKDSEWKSGTKVSRTFSYIKNKM
SSSKKSKEKEKEKDKIKEKEKDSKDKEKDKKTVNGHTFSSIPVVGPISCSQCMKPFTNKDAYTCANCSAFVHKGCRESLA
SCAKVKMKQPKGSLQAHDTSSLPTVIMRNKPSQPKERPRSAVLLVDETATTPIFANRRSQQSVSLSKSVSIQNITGVGND
ENMSNTWKFLSHSTDSLNKISKVNESTESLTDEGVGTDMNEGQLLGDFEIESKQLEAESWSRIIDSKFLKQQKKDVVKRQ
EVIYELMQTEFHHVRTLKIMSGVYSQGMMADLLFEQQMVEKLFPCLDELISIHSQFFQRILERKKESLVDKSEKNFLIKR
IGDVLVNQFSGENAERLKKTYGKFCGQHNQSVNYFKDLYAKDKRFQAFVKKKMSSSVVRRLGIPECILLVTQRITKYPVL
FQRILQCTKDNEVEQEDLAQSLSLVKDVIGAVDSKVASYEKKVRLNEIYTKTDSKSIMRMKSGQMFAKEDLKRKKLVRDG
SVFLKNAAGRLKEVQAVLLTDILVFLQEKDQKYIFASLDQKSTVISLKKLIVREVAHEEKGLFLISMGMTDPEMVEVHAS
SKEERNSWIQIIQDTINTLNRDEDEGIPSENEEEKKMLDTRARELKEQLHQKDQKILLLLEEKEMIFRDMAECSTPLPED
CSPTHSPRVLFRSNTEEALKGGPLMKSAINEVEILQGLVSGNLGGTLGPTVSSPIEQDVVGPVSLPRRAETFGGFDSHQM
NASKGGEKEEGDDGQDLRRTESDSGLKKGGNANLVFMLKRNSEQVVQSVVHLYELLSALQGVVLQQDSYIEDQKLVLSER
ALTRSLSRPSSLIEQEKQRSLEKQRQDLANLQKQQAQYLEEKRRREREWEARERELREREALLAQREEEVQQGQQDLEKE
REELQQKKGTYQYDLERLRAAQKQLEREQEQLRREAERLSQRQTERDLCQVSHPHTKLMRIPSFFPSPEEPPSPSAPSIA
KSGSLDSELSVSPKRNSISRTHKDKGPFHILSSTSQTNKGPEGQSQAPASTSASTRLFGLTKPKEKKEKKKKNKTSRSQP
GDGPASEVSAEGEEIFC