Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU25715 DGAT2L6 DC3 Homo sapiens No Metabolism

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
24 61 21 JHU25715
24 62 21 JHU25715

External Database ID

Nucleotide (1011bp)

>JHU25715
ATGGCTTTCTTCTCCCGACTGAATCTCCAGGAGGGCCTCCAAACCTTCTTTGTTTTGCAATGGATCCCAGTCTATATATT
TTTAGGAGCTATTCCCATTCTCCTTATACCCTACTTTCTGTTATTCAGTAAGTTCTGGCCCTTGGCTGTGCTCTCCTTAG
CCTGGCTCACCTATGATTGGAACACCCACAGTCAAGGTGGCAGGCGTTCAGCTTGGGTACGAAACTGGACCCTATGGAAG
TATTTCCGAAATTACTTCCCAGTAAAGCTGGTGAAGACTCATGATCTTTCTCCCAAACACAACTACATCATTGCCAATCA
CCCCCATGGCATTCTCTCTTTTGGTGTCTTCATCAACTTTGCCACTGAGGCCACTGGCATTGCTCGGATTTTCCCATCCA
TCACTCCCTTTGTAGGGACCTTAGAAAGGATATTTTGGATCCCAATTGTGCGAGAATATGTGATGTCAATGGGTGTGTGC
CCTGTGAGTAGCTCAGCCTTGAAGTACTTGCTGACCCAGAAAGGCTCAGGCAATGCCGTGGTTATTGTGGTGGGTGGAGC
TGCTGAAGCTCTCTTGTGCCGACCAGGAGCCTCCACTCTCTTCCTCAAGCAGCGTAAAGGTTTTGTGAAGATGGCACTGC
AAACAGGGGCATACCTTGTCCCTTCATATTCCTTTGGTGAGAACGAAGTTTTCAATCAGGAGACCTTCCCTGAGGGCACG
TGGTTAAGGTTGTTCCAAAAAACCTTCCAGGACACATTCAAAAAAATCCTGGGACTAAATTTCTGTACCTTCCATGGCCG
GGGCTTCACTCGCGGATCCTGGGGCTTCCTGCCTTTCAATCGGCCCATTACCACTGTTGTTGGGGAACCCCTTCCAATTC
CCAGGATTAAGAGGCCAAACCAGAAGACAGTAGACAAGTATCACGCACTCTACATCAGTGCCCTGCGCAAGCTCTTTGAC
CAACACAAAGTTGAATATGGCCTCCCTGAGACCCAAGAGCTGACAATTACA

Protein (337aa)

>JHU25715
MAFFSRLNLQEGLQTFFVLQWIPVYIFLGAIPILLIPYFLLFSKFWPLAVLSLAWLTYDWNTHSQGGRRSAWVRNWTLWK
YFRNYFPVKLVKTHDLSPKHNYIIANHPHGILSFGVFINFATEATGIARIFPSITPFVGTLERIFWIPIVREYVMSMGVC
PVSSSALKYLLTQKGSGNAVVIVVGGAAEALLCRPGASTLFLKQRKGFVKMALQTGAYLVPSYSFGENEVFNQETFPEGT
WLRLFQKTFQDTFKKILGLNFCTFHGRGFTRGSWGFLPFNRPITTVVGEPLPIPRIKRPNQKTVDKYHALYISALRKLFD
QHKVEYGLPETQELTIT