Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU25696 UBE2Q1 NICE5;UBE2Q Homo sapiens No Nuclear Proteins

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
22 61 24 JHU25696
22 62 24 JHU25696

External Database ID

Nucleotide (1266bp)

>JHU25696
ATGCAGCAGCCGCAGCCGCAGGGGCAGCAGCAGCCGGGGCCGGGGCAGCAGCTGGGGGGCCAGGGGGCGGCGCCGGGGGC
CGGGGGCGGCCCAGGGGGGGGCCCGGGGCCGGGGCCCTGCCTGAGGCGAGAGCTGAAGCTGCTCGAGTCCATCTTCCACC
GCGGCCACGAGCGCTTCCGCATTGCCAGCGCCTGCCTGGACGAGCTGAGCTGCGAGTTCCTGCTGGCTGGGGCCGGAGGG
GCCGGGGCGGGGGCCGCGCCCGGACCGCATCTCCCCCCACGGGGGTCGGTGCCTGGGGATCCTGTCCGCATCCACTGCAA
CATCACGGAGTCATACCCTGCTGTGCCCCCCATCTGGTCGGTGGAGTCTGATGACCCTAACTTGGCTGCTGTCTTGGAGA
GGCTGGTGGACATAAAGAAAGGGAATACTCTGCTATTGCAGCATCTGAAGAGGATCATCTCCGACCTGTGTAAACTCTAT
AACCTCCCTCAGCATCCAGATGTGGAGATGCTGGATCAACCCTTGCCAGCAGAGCAGTGCACACAGGAAGACGTGTCTTC
AGAAGATGAAGATGAGGAGATGCCTGAGGACACAGAAGACTTAGATCACTATGAAATGAAAGAGGAAGAGCCAGCTGAGG
GCAAGAAATCTGAAGATGATGGCATTGGAAAAGAAAACTTGGCCATCCTAGAGAAAATTAAAAAGAACCAGAGGCAAGAT
TACTTAAATGGTGCAGTGTCTGGCTCGGTGCAGGCCACTGACCGGCTGATGAAGGAGCTCAGGGATATATACCGATCACA
GAGTTTCAAAGGCGGAAACTATGCAGTCGAACTCGTGAATGACAGTCTGTATGATTGGAATGTCAAACTCCTCAAAGTTG
ACCAGGACAGCGCTTTGCACAACGATCTCCAGATCCTCAAAGAGAAAGAAGGAGCCGACTTCATTCTACTTAACTTTTCC
TTTAAAGATAACTTTCCCTTTGACCCACCATTTGTCAGGGTTGTGTCTCCAGTCCTCTCTGGAGGGTATGTTCTGGGCGG
AGGGGCCATCTGCATGGAACTTCTCACCAAACAGGGCTGGAGCAGTGCCTACTCCATAGAGTCAGTGATCATGCAGATCA
GTGCCACACTGGTGAAGGGGAAAGCACGAGTGCAGTTTGGAGCCAACAAATCTCAATACAGTCTGACAAGAGCACAGCAG
TCCTACAAGTCCTTGGTGCAGATCCACGAAAAAAACGGCTGGTACACACCCCCAAAAGAAGACGGC

Protein (422aa)

>JHU25696
MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCLRRELKLLESIFHRGHERFRIASACLDELSCEFLLAGAGG
AGAGAAPGPHLPPRGSVPGDPVRIHCNITESYPAVPPIWSVESDDPNLAAVLERLVDIKKGNTLLLQHLKRIISDLCKLY
NLPQHPDVEMLDQPLPAEQCTQEDVSSEDEDEEMPEDTEDLDHYEMKEEEPAEGKKSEDDGIGKENLAILEKIKKNQRQD
YLNGAVSGSVQATDRLMKELRDIYRSQSFKGGNYAVELVNDSLYDWNVKLLKVDQDSALHNDLQILKEKEGADFILLNFS
FKDNFPFDPPFVRVVSPVLSGGYVLGGGAICMELLTKQGWSSAYSIESVIMQISATLVKGKARVQFGANKSQYSLTRAQQ
SYKSLVQIHEKNGWYTPPKEDG