Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU25612 SCN5A Homo sapiens No Cell Death; Kinases; Metabolism

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
23 61 19 JHU25612
23 62 19 JHU25612

External Database ID

Nucleotide (6048bp)

>JHU25612
ATGGCAAACTTCCTATTACCTCGGGGCACCAGCAGCTTCCGCAGGTTCACACGGGAGTCCCTGGCAGCCATCGAGAAGCG
CATGGCAGAGAAGCAAGCCCGCGGCTCAACCACCTTGCAGGAGAGCCGAGAGGGGCTGCCCGAGGAGGAGGCTCCCCGGC
CCCAGCTGGACCTGCAGGCCTCCAAAAAGCTGCCAGATCTCTATGGCAATCCACCCCAAGAGCTCATCGGAGAGCCCCTG
GAGGACCTGGACCCCTTCTATAGCACCCAAAAGACTTTCATCGTACTGAATAAAGGCAAGACCATCTTCCGGTTCAGTGC
CACCAACGCCTTGTATGTCCTCAGTCCCTTCCACCCCATCCGGAGAGCGGCTGTGAAGATTCTGGTTCACTCGCTCTTCA
ACATGCTCATCATGTGCACCATCCTCACCAACTGCGTGTTCATGGCCCAGCACGACCCTCCACCCTGGACCAAGTATGTC
GAGTACACCTTCACCGCCATTTACACCTTTGAGTCTCTGGTCAAGATTCTGGCTCGAGGCTTCTGCCTGCACGCGTTCAC
TTTCCTTCGGGACCCATGGAACTGGCTGGACTTTAGTGTGATTATCATGGCATACACAACTGAATTTGTGGACCTGGGCA
ATGTCTCAGCCTTACGCACCTTCCGAGTCCTCCGGGCCCTGAAAACTATATCAGTCATTTCAGGGCTGAAGACCATCGTG
GGGGCCCTGATCCAGTCTGTGAAGAAGCTGGCTGATGTGATGGTCCTCACAGTCTTCTGCCTCAGCGTCTTTGCCCTCAT
CGGCCTGCAGCTCTTCATGGGCAACCTAAGGCACAAGTGCGTGCGCAACTTCACAGCGCTCAACGGCACCAACGGCTCCG
TGGAGGCCGACGGCTTGGTCTGGGAATCCCTGGACCTTTACCTCAGTGATCCAGAAAATTACCTGCTCAAGAACGGCACC
TCTGATGTGTTACTGTGTGGGAACAGCTCTGACGCTGGGACATGTCCGGAGGGCTACCGGTGCCTAAAGGCAGGCGAGAA
CCCCGACCACGGCTACACCAGCTTCGATTCCTTTGCCTGGGCCTTTCTTGCACTCTTCCGCCTGATGACGCAGGACTGCT
GGGAGCGCCTCTATCAGCAGACCCTCAGGTCCGCAGGGAAGATCTACATGATCTTCTTCATGCTTGTCATCTTCCTGGGG
TCCTTCTACCTGGTGAACCTGATCCTGGCCGTGGTCGCAATGGCCTATGAGGAGCAAAACCAAGCCACCATCGCTGAGAC
CGAGGAGAAGGAAAAGCGCTTCCAGGAGGCCATGGAAATGCTCAAGAAAGAACACGAGGCCCTCACCATCAGGGGTGTGG
ATACCGTGTCCCGTAGCTCCTTGGAGATGTCCCCTTTGGCCCCAGTAAACAGCCATGAGAGAAGAAGCAAGAGGAGAAAA
CGGATGTCTTCAGGAACTGAGGAGTGTGGGGAGGACAGGCTCCCCAAGTCTGACTCAGAAGATGGTCCCAGAGCAATGAA
TCATCTCAGCCTCACCCGTGGCCTCAGCAGGACTTCTATGAAGCCACGTTCCAGCCGCGGGAGCATTTTCACCTTTCGCA
GGCGAGACCTGGGTTCTGAAGCAGATTTTGCAGATGATGAAAACAGCACAGCGGGGGAGAGCGAGAGCCACCACACATCA
CTGCTGGTGCCCTGGCCCCTGCGCCGGACCAGTGCCCAGGGACAGCCCAGTCCCGGAACCTCGGCTCCTGGCCACGCCCT
CCATGGCAAAAAGAACAGCACTGTGGACTGCAATGGGGTGGTCTCATTACTGGGGGCAGGCGACCCAGAGGCCACATCCC
CAGGAAGCCACCTCCTCCGCCCTGTGATGCTAGAGCACCCGCCAGACACGACCACGCCATCGGAGGAGCCAGGCGGGCCC
CAGATGCTGACCTCCCAGGCTCCGTGTGTAGATGGCTTCGAGGAGCCAGGAGCACGGCAGCGGGCCCTCAGCGCAGTCAG
CGTCCTCACCAGCGCACTGGAAGAGTTAGAGGAGTCTCGCCACAAGTGTCCACCATGCTGGAACCGTCTCGCCCAGCGCT
ACCTGATCTGGGAGTGCTGCCCGCTGTGGATGTCCATCAAGCAGGGAGTGAAGTTGGTGGTCATGGACCCGTTTACTGAC
CTCACCATCACTATGTGCATCGTACTCAACACACTCTTCATGGCGCTGGAGCACTACAACATGACAAGTGAATTCGAGGA
GATGCTGCAGGTCGGAAACCTGGTCTTCACAGGGATTTTCACAGCAGAGATGACCTTCAAGATCATTGCCCTCGACCCCT
ACTACTACTTCCAACAGGGCTGGAACATCTTCGACAGCATCATCGTCATCCTTAGCCTCATGGAGCTGGGCCTGTCCCGC
ATGAGCAACTTGTCGGTGCTGCGCTCCTTCCGCCTGCTGCGGGTCTTCAAGCTGGCCAAATCATGGCCCACCCTGAACAC
ACTCATCAAGATCATCGGGAACTCAGTGGGGGCACTGGGGAACCTGACACTGGTGCTAGCCATCATCGTGTTCATCTTTG
CTGTGGTGGGCATGCAGCTCTTTGGCAAGAACTACTCGGAGCTGAGGGACAGCGACTCAGGCCTGCTGCCTCGCTGGCAC
ATGATGGACTTCTTTCATGCCTTCCTCATCATCTTCCGCATCCTCTGTGGAGAGTGGATCGAGACCATGTGGGACTGCAT
GGAGGTGTCGGGGCAGTCATTATGCCTGCTGGTCTTCTTGCTTGTTATGGTCATTGGCAACCTTGTGGTCCTGAATCTCT
TCCTGGCCTTGCTGCTCAGCTCCTTCAGTGCAGACAACCTCACAGCCCCTGATGAGGACAGAGAGATGAACAACCTCCAG
CTGGCCCTGGCCCGCATCCAGAGGGGCCTGCGCTTTGTCAAGCGGACCACCTGGGATTTCTGCTGTGGTCTCCTGCGGCA
GCGGCCTCAGAAGCCCGCAGCCCTTGCCGCCCAGGGCCAGCTGCCCAGCTGCATTGCCACCCCCTACTCCCCGCCACCCC
CAGAGACGGAGAAGGTGCCTCCCACCCGCAAGGAAACACGGTTTGAGGAAGGCGAGCAACCAGGCCAGGGCACCCCCGGG
GATCCAGAGCCCGTGTGTGTGCCCATCGCTGTGGCCGAGTCAGACACAGATGACCAAGAAGAAGATGAGGAGAACAGCCT
GGGCACGGAGGAGGAGTCCAGCAAGCAGCAGGAATCCCAGCCTGTGTCCGGTGGCCCAGAGGCCCCTCCGGATTCCAGGA
CCTGGAGCCAGGTGTCAGCGACTGCCTCCTCTGAGGCCGAGGCCAGTGCATCTCAGGCCGACTGGCGGCAGCAGTGGAAA
GCGGAACCCCAGGCCCCAGGGTGCGGTGAGACCCCAGAGGACAGTTGCTCCGAGGGCAGCACAGCAGACATGACCAACAC
CGCTGAGCTCCTGGAGCAGATCCCTGACCTCGGCCAGGATGTCAAGGACCCAGAGGACTGCTTCACTGAAGGCTGTGTCC
GGCGCTGTCCCTGCTGTGCGGTGGACACCACACAGGCCCCAGGGAAGGTCTGGTGGCGGTTGCGCAAGACCTGCTACCAC
ATCGTGGAGCACAGCTGGTTCGAGACATTCATCATCTTCATGATCCTACTCAGCAGTGGAGCGCTGGCCTTCGAGGACAT
CTACCTAGAGGAGCGGAAGACCATCAAGGTTCTGCTTGAGTATGCCGACAAGATGTTCACATATGTCTTCGTGCTGGAGA
TGCTGCTCAAGTGGGTGGCCTACGGCTTCAAGAAGTACTTCACCAATGCCTGGTGCTGGCTCGACTTCCTCATCGTAGAC
GTCTCTCTGGTCAGCCTGGTGGCCAACACCCTGGGCTTTGCCGAGATGGGCCCCATCAAGTCACTGCGGACGCTGCGTGC
ACTCCGTCCTCTGAGAGCTCTGTCACGATTTGAGGGCATGAGGGTGGTGGTCAATGCCCTGGTGGGCGCCATCCCGTCCA
TCATGAACGTCCTCCTCGTCTGCCTCATCTTCTGGCTCATCTTCAGCATCATGGGCGTGAACCTCTTTGCGGGGAAGTTT
GGGAGGTGCATCAACCAGACAGAGGGAGACTTGCCTTTGAACTACACCATCGTGAACAACAAGAGCCAGTGTGAGTCCTT
GAACTTGACCGGAGAATTGTACTGGACCAAGGTGAAAGTCAACTTTGACAACGTGGGGGCCGGGTACCTGGCCCTTCTGC
AGGTGGCAACATTTAAAGGCTGGATGGACATTATGTATGCAGCTGTGGACTCCAGGGGGTATGAAGAGCAGCCTCAGTGG
GAATACAACCTCTACATGTACATCTATTTTGTCATTTTCATCATCTTTGGGTCTTTCTTCACCCTGAACCTCTTTATTGG
TGTCATCATTGACAACTTCAACCAACAGAAGAAAAAGTTAGGGGGCCAGGACATCTTCATGACAGAGGAGCAGAAGAAGT
ACTACAATGCCATGAAGAAGCTGGGCTCCAAGAAGCCCCAGAAGCCCATCCCACGGCCCCTGAACAAGTACCAGGGCTTC
ATATTCGACATTGTGACCAAGCAGGCCTTTGACGTCACCATCATGTTTCTGATCTGCTTGAATATGGTGACCATGATGGT
GGAGACAGATGACCAAAGTCCTGAGAAAATCAACATCTTGGCCAAGATCAACCTGCTCTTTGTGGCCATCTTCACAGGCG
AGTGTATTGTCAAGCTGGCTGCCCTGCGCCACTACTACTTCACCAACAGCTGGAATATCTTCGACTTCGTGGTTGTCATC
CTCTCCATCGTGGGCACTGTGCTCTCGGACATCATCCAGAAGTACTTCTTCTCCCCGACGCTCTTCCGAGTCATCCGCCT
GGCCCGAATAGGCCGCATCCTCAGACTGATCCGAGGGGCCAAGGGGATCCGCACGCTGCTCTTTGCCCTCATGATGTCCC
TGCCTGCCCTCTTCAACATCGGGCTGCTGCTCTTCCTCGTCATGTTCATCTACTCCATCTTTGGCATGGCCAACTTCGCT
TATGTCAAGTGGGAGGCTGGCATCGACGACATGTTCAACTTCCAGACCTTCGCCAACAGCATGCTGTGCCTCTTCCAGAT
CACCACGTCGGCCGGCTGGGATGGCCTCCTCAGCCCCATCCTCAACACTGGGCCGCCCTACTGCGACCCCACTCTGCCCA
ACAGCAATGGCTCTCGGGGGGACTGCGGGAGCCCAGCCGTGGGCATCCTCTTCTTCACCACCTACATCATCATCTCCTTC
CTCATCGTGGTCAACATGTACATTGCCATCATCCTGGAGAACTTCAGCGTGGCCACGGAGGAGAGCACCGAGCCCCTGAG
TGAGGACGACTTCGATATGTTCTATGAGATCTGGGAGAAATTTGACCCAGAGGCCACTCAGTTTATTGAGTATTCGGTCC
TGTCTGACTTTGCCGATGCCCTGTCTGAGCCACTCCGTATCGCCAAGCCCAACCAGATAAGCCTCATCAACATGGACCTG
CCCATGGTGAGTGGGGACCGCATCCATTGCATGGACATTCTCTTTGCCTTCACCAAAAGGGTCCTGGGGGAGTCTGGGGA
GATGGACGCCCTGAAGATCCAGATGGAGGAGAAGTTCATGGCAGCCAACCCATCCAAGATCTCCTACGAGCCCATCACCA
CCACACTCCGGCGCAAGCACGAAGAGGTGTCGGCCATGGTTATCCAGAGAGCCTTCCGCAGGCACCTGCTGCAACGCTCT
TTGAAGCATGCCTCCTTCCTCTTCCGTCAGCAGGCGGGCAGCGGCCTCTCCGAAGAGGATGCCCCTGAGCGAGAGGGCCT
CATCGCCTACGTGATGAGTGAGAACTTCTCCCGACCCCTTGGCCCACCCTCCAGCTCCTCCATCTCCTCCACTTCCTTCC
CACCCTCCTATGACAGTGTCACTAGAGCCACCAGCGATAACCTCCAGGTGCGGGGGTCTGACTACAGCCACAGTGAAGAT
CTCGCCGACTTCCCCCCTTCTCCGGACAGGGACCGTGAGTCCATCGTG

Protein (2016aa)

>JHU25612
MANFLLPRGTSSFRRFTRESLAAIEKRMAEKQARGSTTLQESREGLPEEEAPRPQLDLQASKKLPDLYGNPPQELIGEPL
EDLDPFYSTQKTFIVLNKGKTIFRFSATNALYVLSPFHPIRRAAVKILVHSLFNMLIMCTILTNCVFMAQHDPPPWTKYV
EYTFTAIYTFESLVKILARGFCLHAFTFLRDPWNWLDFSVIIMAYTTEFVDLGNVSALRTFRVLRALKTISVISGLKTIV
GALIQSVKKLADVMVLTVFCLSVFALIGLQLFMGNLRHKCVRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGT
SDVLLCGNSSDAGTCPEGYRCLKAGENPDHGYTSFDSFAWAFLALFRLMTQDCWERLYQQTLRSAGKIYMIFFMLVIFLG
SFYLVNLILAVVAMAYEEQNQATIAETEEKEKRFQEAMEMLKKEHEALTIRGVDTVSRSSLEMSPLAPVNSHERRSKRRK
RMSSGTEECGEDRLPKSDSEDGPRAMNHLSLTRGLSRTSMKPRSSRGSIFTFRRRDLGSEADFADDENSTAGESESHHTS
LLVPWPLRRTSAQGQPSPGTSAPGHALHGKKNSTVDCNGVVSLLGAGDPEATSPGSHLLRPVMLEHPPDTTTPSEEPGGP
QMLTSQAPCVDGFEEPGARQRALSAVSVLTSALEELEESRHKCPPCWNRLAQRYLIWECCPLWMSIKQGVKLVVMDPFTD
LTITMCIVLNTLFMALEHYNMTSEFEEMLQVGNLVFTGIFTAEMTFKIIALDPYYYFQQGWNIFDSIIVILSLMELGLSR
MSNLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKNYSELRDSDSGLLPRWH
MMDFFHAFLIIFRILCGEWIETMWDCMEVSGQSLCLLVFLLVMVIGNLVVLNLFLALLLSSFSADNLTAPDEDREMNNLQ
LALARIQRGLRFVKRTTWDFCCGLLRQRPQKPAALAAQGQLPSCIATPYSPPPPETEKVPPTRKETRFEEGEQPGQGTPG
DPEPVCVPIAVAESDTDDQEEDEENSLGTEEESSKQQESQPVSGGPEAPPDSRTWSQVSATASSEAEASASQADWRQQWK
AEPQAPGCGETPEDSCSEGSTADMTNTAELLEQIPDLGQDVKDPEDCFTEGCVRRCPCCAVDTTQAPGKVWWRLRKTCYH
IVEHSWFETFIIFMILLSSGALAFEDIYLEERKTIKVLLEYADKMFTYVFVLEMLLKWVAYGFKKYFTNAWCWLDFLIVD
VSLVSLVANTLGFAEMGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKF
GRCINQTEGDLPLNYTIVNNKSQCESLNLTGELYWTKVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRGYEEQPQW
EYNLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKYQGF
IFDIVTKQAFDVTIMFLICLNMVTMMVETDDQSPEKINILAKINLLFVAIFTGECIVKLAALRHYYFTNSWNIFDFVVVI
LSIVGTVLSDIIQKYFFSPTLFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMANFA
YVKWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPTLPNSNGSRGDCGSPAVGILFFTTYIIISF
LIVVNMYIAIILENFSVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDL
PMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRS
LKHASFLFRQQAGSGLSEEDAPEREGLIAYVMSENFSRPLGPPSSSSISSTSFPPSYDSVTRATSDNLQVRGSDYSHSED
LADFPPSPDRDRESIV