Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU25279 IL12RB1 IL12R;IL12RB Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone

External Database ID

Nucleotide (1986bp)

>JHU25279
ATGGAGCCGCTGGTGACCTGGGTGGTCCCCCTCCTCTTCCTCTTCCTGCTGTCCAGGCAGGGCGCTGCCTGCAGAACCAG
TGAGTGCTGTTTTCAGGACCCGCCATATCCGGATGCAGACTCAGGCTCGGCCTCGGGCCCTAGGGACCTGAGATGCTATC
GGATATCCAGTGATCGTTACGAGTGCTCCTGGCAGTATGAGGGTCCCACAGCTGGGGTCAGCCACTTCCTGCGGTGTTGC
CTTAGCTCCGGGCGCTGCTGCTACTTCGCCGCCGGCTCAGCCACCAGGCTGCAGTTCTCCGACCAGGCTGGGGTGTCTGT
GCTGTACACTGTCACACTCTGGGTGGAATCCTGGGCCAGGAACCAGACAGAGAAGTCTCCTGAGGTGACCCTGCAGCTCT
ACAACTCAGTTAAATATGAGCCTCCTCTGGGAGACATCAAGGTGTCCAAGTTGGCCGGGCAGCTGCGTATGGAGTGGGAG
ACCCCGGATAACCAGGTTGGTGCTGAGGTGCAGTTCCGGCACCGGACACCCAGCAGCCCATGGAAGTTGGGCGACTGCGG
ACCTCAGGATGATGATACTGAGTCCTGCCTCTGCCCCCTGGAGATGAATGTGGCCCAGGAATTCCAGCTCCGACGACGGC
AGTTGGGGAGCCAAGGAAGTTCCTGGAGCAAGTGGAGCAGCCCCGTGTGCGTTCCCCCTGAAAACCCCCCACAGCCTCAG
GTGAGATTCTCGGTGGAGCAGCTGGGCCAGGATGGGAGGAGGCGGCTGACCCTGAAAGAGCAGCCAACCCAGCTGGAGCT
TCCAGAAGGCTGTCAAGGGCTGGCGCCTGGCACGGAGGTCACTTACCGACTACAGCTCCACATGCTGTCCTGCCCGTGTA
AGGCCAAGGCCACCGGGACCCTGCACCTGGGGAAGATGCCCTATCTCTCGGGTGCTGCCTACAACGTGGCTGTCATCTCC
TCGAACCAATTTGGTCCTGGCCTGAACCAGACGTGGCACATTCCTGCCGACACCCACACAGAACCAGTGGCTCTGAATAT
CAGCGTCGGAACCAACGGGACCACCATGTATTGGCCAGCCCGGGCTCAGAGCATGACGTATTGCATTGAATGGCAGCCTG
TGGGCCAGGACGGGGGCCTTGCCACCTGCAGCCTGACTGCGCCGCAAGACCCGGATCCGGCTGGAATGGCAACCTACAGC
TGGAGTCGAGGGTCTGGGGCAATGGGGCAGGAAAAGTGTTACTACATTACCATCTTTGCCTCTGCGCACCCCGAGAAGCT
CACCTTGTGGTCTACGGTCCTGTCCACCTACCACTTTGGGGGCAATGCCTCAGCAGCTGGGACACCGCACCACGTCTCGG
TGAAGAATCATAGCTTGGACTCTGTGTCTGTGGACTGGGCACCATCCCTGCTGAGCACCTGTCCCGGCGTCCTAAAGGAG
TATGTTGTCCGCTGCCGAGATGAAGACAGCAAACAGGTGTCAGAGCATCCCGTGCAGCCCACAGAGACCCAAGTTACCCT
CAGTGGCCTGCGGGCTGGTGTAGCCTACACGGTGCAGGTGCGAGCAGACACAGCGTGGCTGAGGGGTGTCTGGAGCCAGC
CCCAGCGCTTCAGCATCGAAGTGCAGGTTTCTGATTGGCTCATCTTCTTCGCCTCCCTGGGGAGCTTCCTGAGCATCCTT
CTCGTGGGCGTCCTTGGCTACCTTGGCCTGAACAGGGCCGCACGGCACCTGTGCCCGCCGCTGCCCACACCCTGTGCCAG
CTCCGCCATTGAGTTCCCTGGAGGGAAGGAGACTTGGCAGTGGATCAACCCGGTGGACTTCCAGGAAGAGGCATCCCTGC
AGGAGGCCCTGGTGGTAGAGATGTCCTGGGACAAAGGCGAGAGGACCGAGCCTCTCGAGAAGACAGAGCTACCTGAGGGT
GCCCCTGAGCTGGCCCTGGGTACAGAGTTGTCCTTGGAGGATGGAGACAGGTGCAAGGCCAAGATG

Protein (662aa)

>JHU25279
MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCC
LSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWE
TPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQ
VRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATGTLHLGKMPYLSGAAYNVAVIS
SNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYS
WSRGSGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKE
YVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSDWLIFFASLGSFLSIL
LVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQWINPVDFQEEASLQEALVVEMSWDKGERTEPLEKTELPEG
APELALGTELSLEDGDRCKAKM