Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00324 IP6K1 IHPK1;KIAA0263 Homo sapiens Yes Kinases; Nuclear Proteins

HuProt v2.0
Block Row Column Clone
15 1 5 JHU00324
15 1 6 JHU00324
HuProt v3.0
Block Row Column Clone
3 1 30 JHU00324
3 2 30 JHU00324
HuProt v3.1
Block Row Column Clone
3 1 30 JHU00324
3 2 30 JHU00324

External Database ID

Nucleotide (1326bp)

>JHU00324
ATGTGTGTTTGTCAAACCATGGAAGTGGGGCAGTATGGCAAGAATGCAAGTCGGGCTGGAGACCGGGGAGTCCTCCTGGA
GCCCTTCATCCACCAAGTAGGCGGACACAGCAGCATGATGCGTTACGACGATCACACTGTGTGCAAGCCCCTCATCTCCC
GGGAACAGCGCTTTTACGAGTCCCTCCCTCCCGAAATGAAGGAGTTCACCCCTGAATACAAAGGCGTGGTATCTGTCTGT
TTTGAGGGGGACAGTGATGGTTACATCAACTTAGTGGCCTATCCTTATGTGGAAAGTGAGACTGTGGAACAGGATGACAC
AACAGAACGGGAGCAACCTCGGCGCAAACACTCCCGCCGGAGCCTGCACCGGTCAGGCAGTGGCAGTGACCACAAGGAGG
AGAAAGCCAGCCTGTCCCTTGAGACCTCTGAGAGCTCACAGGAGGCAAAGAGTCCGAAGGTGGAGCTGCACAGCCACTCA
GAGGTCCCTTTCCAGATGCTAGATGGCAACAGTGGCTTGAGTTCTGAGAAGATCAGCCACAACCCCTGGAGCCTGCGTTG
TCACAAGCAGCAGCTGAGCCGCATGCGCTCCGAGTCCAAGGACCGAAAGCTCTACAAGTTCCTCCTGCTTGAGAACGTGG
TGCACCACTTCAAGTACCCCTGCGTGTTGGACCTGAAGATGGGCACGCGGCAGCATGGCGATGACGCGTCAGCTGAGAAG
GCAGCCCGGCAGATGCGGAAATGCGAGCAGAGCACATCAGCCACGCTGGGCGTCAGGGTCTGCGGCATGCAGGTGTACCA
GCTGGACACAGGGCATTACCTCTGCAGGAACAAGTACTATGGCCGTGGGCTCTCCATTGAAGGCTTCCGCAATGCCCTCT
ATCAATATCTGCACAATGGCCTGGACCTGCGACGTGACCTGTTTGAGCCTATCCTGAGCAAACTGCGGGGCCTGAAAGCT
GTGCTGGAGCGGCAGGCCTCTTACCGCTTCTACTCCAGTTCCCTGCTTGTCATCTATGATGGCAAGGAGTGCCGGGCTGA
GTCCTGCCTGGACCGCCGGTCTGAGATGCGTCTCAAGCACCTGGACATGGTGCTCCCTGAGGTGGCGTCATCCTGTGGCC
CCAGCACCAGCCCCAGCAACACCAGCCCCGAGGCGGGTCCCTCCTCTCAGCCCAAGGTGGATGTCCGCATGATTGACTTT
GCACACAGCACATTCAAGGGCTTCCGGGATGACCCCACCGTGCATGATGGGCCAGACAGAGGCTACGTGTTTGGCCTGGA
GAACCTCATCAGCATCATGGAACAGATGCGGGACGAGAACCAGTAG

Protein (441aa)

>JHU00324
MCVCQTMEVGQYGKNASRAGDRGVLLEPFIHQVGGHSSMMRYDDHTVCKPLISREQRFYESLPPEMKEFTPEYKGVVSVC
FEGDSDGYINLVAYPYVESETVEQDDTTEREQPRRKHSRRSLHRSGSGSDHKEEKASLSLETSESSQEAKSPKVELHSHS
EVPFQMLDGNSGLSSEKISHNPWSLRCHKQQLSRMRSESKDRKLYKFLLLENVVHHFKYPCVLDLKMGTRQHGDDASAEK
AARQMRKCEQSTSATLGVRVCGMQVYQLDTGHYLCRNKYYGRGLSIEGFRNALYQYLHNGLDLRRDLFEPILSKLRGLKA
VLERQASYRFYSSSLLVIYDGKECRAESCLDRRSEMRLKHLDMVLPEVASSCGPSTSPSNTSPEAGPSSQPKVDVRMIDF
AHSTFKGFRDDPTVHDGPDRGYVFGLENLISIMEQMRDENQ