Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00320 HPCAL1 BDR1 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
29 1 9 JHU00320
29 1 10 JHU00320
15 1 13 JHU00320
15 1 14 JHU00320
HuProt v3.0
Block Row Column Clone
2 1 31 JHU00320
2 2 31 JHU00320
1 1 30 JHU00320
1 2 30 JHU00320
HuProt v3.1
Block Row Column Clone
2 1 31 JHU00320
2 2 31 JHU00320
1 1 30 JHU00320
1 2 30 JHU00320

External Database ID

Nucleotide (582bp)

>JHU00320
ATGGGCAAACAGAACAGCAAGCTGCGGCCCGAGGTGCTGCAGGACCTGCGGGAGAACACGGAGTTCACCGACCACGAGCT
GCAGGAGTGGTACAAGGGCTTCCTCAAGGACTGCCCCACCGGCCACCTGACCGTGGACGAGTTCAAGAAGATCTACGCCA
ACTTCTTCCCCTACGGCGACGCTTCCAAGTTCGCCGAGCACGTCTTCCGCACCTTCGACACCAACGGCGACGGCACCATC
GACTTCCGGGAGTTCATCATTGCGCTGAGCGTGACCTCGCGGGGCAAGCTGGAGCAGAAGCTCAAGTGGGCCTTCAGCAT
GTACGACCTGGACGGCAACGGCTACATCAGCCGCAGCGAGATGCTGGAGATCGTGCAGGCCATCTACAAGATGGTGTCGT
CTGTGATGAAGATGCCGGAGGATGAGTCCACCCCGGAGAAGCGCACAGACAAGATCTTCAGGCAGATGGACACCAACAAT
GACGGCAAACTGTCCTTGGAAGAATTCATCAGAGGTGCCAAGAGCGACCCCTCCATCGTCCGCCTGCTGCAGTGCGACCC
CAGCAGTGCCAGTCAGTTCTAG

Protein (193aa)

>JHU00320
MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTI
DFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNN
DGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF