Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00032 GIT2 KIAA0148 Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
2 1 5 JHU00032
2 1 6 JHU00032
HuProt v3.0
Block Row Column Clone
3 1 5 JHU00032
3 2 5 JHU00032
HuProt v3.1
Block Row Column Clone
3 1 5 JHU00032
3 2 5 JHU00032

External Database ID

Nucleotide (1416bp)

>JHU00032
ATGTCGAAACGGCTCCGGAGCAGCGAGGTGTGCGCTGACTGCAGCGGGCCGGATCCTTCCTGGGCATCAGTAAATAGGGG
AACGTTTTTATGTGATGAGTGCTGCAGTGTCCATCGGAGTCTAGGGCGCCATATCTCCCAAGTGAGGCATCTGAAACACA
CACCGTGGCCTCCAACACTGCTTCAGATGGTTGAGACCTTGTATAATAACGGTGCTAACTCTATATGGGAGCATTCTTTG
CTGGACCCTGCGTCTATTATGAGTGGAAGACGTAAAGCTAATCCACAGGATAAAGTACATCCCAATAAAGCGGAATTCAT
CAGAGCCAAGTATCAGATGTTAGCGTTCGTCCATCGCTTGCCCTGCCGGGATGACGATAGTGTGACTGCCAAAGATCTTA
GCAAGCAACTCCATTCGAGCGTGAGAACAGGGAATCTTGAAACCTGTTTGAGACTGTTATCTTTAGGAGCACAAGCCAAC
TTCTTTCATCCTGAAAAAGGAAACACCCCACTCCATGTTGCCTCCAAAGCAGGGCAGATTTTACAGGCTGAATTATTGGC
AGTATATGGAGCAGACCCAGGCACACAGGATTCTAGTGGGAAAACTCCCGTTGATTATGCAAGGCAAGGAGGGCACCATG
AGCTGGCAGAGCGCCTCGTGGAAATACAGTATGAGCTAACGGACAGACTAGCCTTCTATCTCTGTGGCAGGAAACCAGAT
CACAAAAATGGACAGCACTTTATAATACCTCAAATGGCAGACAGCAGCCTGGATTTGTCTGAATTGGCAAAAGCTGCTAA
GAAGAAACTTCAATCTCTAAGTAATCATTTGTTTGAAGAACTTGCCATGGATATGTACGATGAAGTTGACAGGCGAGAGA
CGGATGCAGTCTGGCTTGCCACGCAAAACCACAGCGCCCTGGTAACCGAGACAACGGTCGTCCCCTTTCTTCCGGTCAAT
CCTGAGTACTCATCAACACGAAATCAGGGCAGACAGAAGTTAGCTCGGTTCAACGCCCATGAGTTTGCCACGCTGGTCAT
TGACATTCTCAGTGACGCCAAGAGGAGACAGCAGGGCAGTTCTCTCTCGGGTTCAAAAGACAATGTGGAGCTCATACTGA
AAACCATCAATAACCAGCACAGCGTTGAGAGTCAAGACAACGATCAGCCCGACTATGACAGCGTGGCATCAGACGAAGAC
ACAGATTTGGAAACCACTGCAAGCAAAACAAACCGGCAGAAGAGCCTAGATTCAGATTTATCAGATGGACCAGTCACTGT
ACAGGAATTTATGGAGGTCAAAAACGCTCTAGTGGCTTCTGAGGCCAAGATACAGCAGCTAATGAAGGTGAATAACAACT
TGAGTGACGAGCTGAGAATTATGCAGAAAAAGTTGCTTGGAAAAGATGCTAATTAG

Protein (471aa)

>JHU00032
MSKRLRSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLKHTPWPPTLLQMVETLYNNGANSIWEHSL
LDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRLPCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQAN
FFHPEKGNTPLHVASKAGQILQAELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGRKPD
HKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEELAMDMYDEVDRRETDAVWLATQNHSALVTETTVVPFLPVN
PEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGSSLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDED
TDLETTASKTNRQKSLDSDLSDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLLGKDAN