Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU24743 ABCC10 MRP7;SIMRP7 Homo sapiens No Membrane Proteins

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
24 61 16 JHU24743
24 62 16 JHU24743

External Database ID

Nucleotide (4392bp)

>JHU24743
ATGTGCCTCCTTGTCTTCCCCCTTGTCCCCAGGAGTCCAGATTACATCCTACCCTGCAGTCCTGGATGGCGCCTCCGACT
TGCAGCTTCCTTCCTGCTTTCCGTCTTCCCGCTGCTAGACCTTCTTCCAGTTGCTTTGCCACCAGGGGCAGGCCCAGGAC
CCATAGGGCTAGAGGTGTTGGCAGGGTGCGTGGCAGCTGTGGCCTGGATCAGCCACAGCCTGGCCCTGTGGGTGTTGGCA
CATTCCCCTCATGGCCACTCCCGGGGTCCCTTGGCCTTGGCCCTGGTAGCCTTGCTGCCAGCTCCAGCCCTAGTGCTGAC
CGTGTTGTGGCATTGCCAGCGAGGCACACTTCTGCCCCCACTTCTCCCAGGGCCCATGGCCCGCCTATGCTTGCTCATCC
TGCAGCTGGCTGCACTCTTGGCCTATGCACTGGGATGGGCAGCTCCTGGGGGACCACGAGAACCCTGGGCTCAGGAGCCC
CTCCTGCCCGAGGATCAAGAACCTGAGGTGGCTGAAGATGGGGAGAGTTGGCTGTCACGCTTTTCCTATGCCTGGCTGGC
ACCCTTGCTGGCCCGTGGGGCCTGTGGAGAGCTCCGGCAGCCTCAGGACATTTGCCGCCTCCCCCACAGACTGCAGCCAA
CCTACCTGGCTCGTGTCTTCCAGGCACACTGGCAGGAGGGGGCACGGCTGTGGAGGGCCTTGTATGGGGCCTTTGGACGG
TGCTATCTGGCACTTGGACTGCTGAAGCTGGTGGGGACCATGTTGGGATTCTCAGGGCCCCTGTTGCTCTCCCTACTGGT
GGGCTTCCTGGAAGAGGGGCAGGAGCCACTAAGCCACGGCCTGCTCTATGCTCTGGGGCTAGCCGGTGGGGCTGTGCTGG
GTGCTGTGCTGCAGAATCAGTATGGGTATGAGGTATATAAGGTAACACTTCAGGCACGGGGGGCTGTGCTGAACATCCTG
TACTGCAAGGCTTTACAGCTGGGGCCCAGCCGCCCTCCTACTGGGGAGGCCCTGAACCTACTAGGCACTGACTCTGAACG
GCTGCTTAACTTTGCTGGGAGCTTCCATGAAGCCTGGGGCCTGCCCCTGCAACTGGCCATCACCCTCTACCTGCTGTACC
AGCAGGTAGGCGTGGCCTTCGTGGGTGGTCTCATCTTGGCACTGCTGCTGGTACCCGTCAACAAAGTGATTGCCACCCGC
ATCATGGCCAGCAACCAGGAAATGCTACAGCACAAGGATGCGCGGGTTAAGCTTGTGACAGAGCTGCTGAGTGGCATTCG
GGTCATCAAGTTCTGCGGGTGGGAGCAGGCACTGGGAGCCCGAGTAGAGGCCTGCCGGGCTCGAGAGCTGGGGCGACTCC
GGGTCATCAAATACCTGGATGCGGCCTGTGTATACCTGTGGGCTGCCCTACCGGTTGTCATCTCCATCGTTATCTTCATC
ACCTATGTCCTCATGGGGCACCAGCTCACTGCCACCAAGGTGTTCACGGCCCTGGCACTGGTGCGAATGCTCATTCTTCC
TCTCAACAACTTCCCTTGGGTGATCAATGGTCTCCTGGAGGCCAAAGTGTCCTTGGACCGGATCCAGCTTTTCCTCGACC
TTCCAAACCACAACCCCCAGGCCTACTACAGCCCAGATTGTGGTAGATTAGGAGCCCAAATCAAGTGGCTTCTCTGTTCA
GATCCCCCTGCAGAGCCATCTACAGTATTGGAGCTGCATGGAGCCTTGTTCTCCTGGGACCCAGTTGGAACCAGCCTGGA
GACCTTCATCAGTCATCTCGAAGTGAAAAAGGGTATGCTGGTGGGCATCGTGGGGAAGGTCGGCTGTGGGAAGAGCTCCC
TGCTGGCTGCCATCGCTGGAGAGCTCCACAGGCTGCGTGGGCATGTGGCAGTGCGGGGGCTGTCCAAGGGCTTTGGCCTG
GCCACCCAGGAACCCTGGATCCAGTTTGCCACCATCCGAGACAACATCCTCTTTGGGAAGACATTTGATGCACAGCTGTA
CAAGGAGGTGCTAGAAGCCTGCGCCCTCAATGATGACCTCAGTATCCTGCCTGCTGGAGACCAGACAGAGGTGGGGGAGA
AGGGTGTCACCCTTAGCGGAGGACAGCGTGCCCGGATTGCCCTTGCTCGTGCTGTCTACCAGGAAAAGGAGCTCTATCTC
CTCGATGACCCTCTGGCCGCTGTGGATGCAGATGTGGCCAACCACCTGCTGCACAGGTGCATCCTGGGCATGCTGAGCTA
CACCACACGGCTGCTCTGCACCCACCGCACTGAGTACCTGGAGAGGGCTGACGCGGTGCTGCTGATGGAGGCCGGGCGCC
TCATCCGGGCTGGACCTCCCTCTGAGATTCTGCCACTGGTACAAGCTGTCCCCAAAGCCTGGGCTGAGAATGGACAAGAG
TCTGACTCAGCCACAGCCCAGTCAGTACAGAACCCAGAGAAAACAAAGGAGGGGCTGGAGGAGGAGCAGAGCACATCTGG
TCGCCTGCTGCAGGAAGAAAGCAAGAAGGAGGGCGCCGTGGCCTTGCACGTGTACCAAGCTTACTGGAAGGCCGTGGGCC
AGGGCTTGGCCTTAGCCATCCTCTTCTCTCTGCTTCTCATGCAAGCCACGCGGAACGCTGCTGACTGGTGGCTCTCCCAC
TGGATCTCTCAGCTGAAGGCTGAGAATAGCTCCCAGGAGGCGCAACCCTCCACCAGCCCAGCTTCTATGGGGCTCTTCTC
TCCGCAGCTGCTCCTCTTTTCCCCTGGAAACCTCTACATCCCAGTGTTCCCACTGCCCAAAGCTGCCCCCAATGGCTCCT
CAGACATCCGTTTCTACCTCACCGTGTATGCGACCATTGCTGGTGTAAATTCCCTCTGCACCCTTCTCCGGGCAGTGCTC
TTTGCAGCAGGCACCCTTCAAGCAGCTGCCACTCTGCATCGCCGCCTGCTGCATCGAGTCCTTATGGCACCAGTGACTTT
CTTCAATGCCACACCCACGGGCCGGATCCTAAACCGCTTCTCCTCTGATGTGGCCTGTGCGGATGACAGCCTGCCCTTCA
TCCTCAACATCCTCCTGGCCAACGCGGCAGGCCTGCTGGGGCTCCTGGCCGTGCTGGGCTCTGGCCTGCCCTGGCTGCTG
CTCCTGCTGCCGCCTTTGAGCATCATGTACTATCACGTGCAGCGCCACTACAGGGCCTCCTCACGGGAGCTGCGGCGCCT
GGGCAGCCTCACCCTGTCTCCACTGTATAGCCATCTGGCCGATACCTTGGCTGGCCTCTCTGTGCTCCGGGCCACAGGGG
CCACCTACAGGTTTGAGGAGGAGAACCTGCGACTCCTTGAGCTAAACCAGAGGTGCCAGTTTGCCACCAGTGCCACAATG
CAGTGGCTGGACATTCGGCTACAGCTCATGGGGGCGGCAGTGGTCAGCGCTATCGCAGGCATCGCTCTGGTGCAGCACCA
GCAGGGCCTCGCTAACCCAGGGCTGGTGGGCTTGTCGCTGTCTTATGCCCTGTCCCTGACGGGCCTGCTCTCGGGCCTGG
TGAGCAGCTTCACACAGACAGAGGCCATGCTGGTGAGCGTCGAGCGGCTGGAAGAGTACACCTGTGACCTGCCCCAGGAA
CCCCAGGGCCAGCCACTGCAGCTGGGCACCGGCTGGCTGACCCAGGGGGGCGTGGAGTTCCAGGACGTGGTGTTGGCGTA
CCGGCCAGGGCTGCCGAATGCCCTGGATGGAGTGACCTTCTGCGTGCAGCCTGGAGAGAAGTTGGGCATCGTGGGCCGCA
CAGGCTCCGGCAAGTCTTCCCTGTTGTTGGTGCTCTTCCGGCTGCTAGAGCCCAGTTCAGGGCGAGTGCTGCTGGACGGC
GTGGACACCAGCCAGCTGGAGCTGGCCCAGCTCAGATCCCAGTTGGCTATCATCCCCCAGGAGCCCTTTTTGTTCAGTGG
GACTGTTCGGGAAAACCTGGACCCCCAGGGCCTACATAAGGACAGGGCCTTGTGGCAGGCCCTGAAGCAGTGCCACCTGA
GTGAGGTGATTACATCCATGGGTGGTCTGGATGGTGAGCTGGGTGAGGGGGGCCGGAGCTTATCTCTTGGGCAGAGGCAG
CTGTTGTGTTTGGCCAGGGCTCTCCTCACAGATGCCAAGATCCTGTGTATCGATGAGGCCACAGCAAGTGTGGACCAGAA
GACAGACCAGCTGCTCCAGCAGACCATCTGCAAACGCTTTGCCAACAAGACAGTGCTGACCATTGCCCATAGGCTCAACA
CGATCCTGAACTCAGACCGGGTGCTGGTGCTACAAGCGGGGAGAGTGGTAGAGCTGGACTCCCCGGCCACCCTGCGCAAC
CAGCCCCACTCCCTGTTCCAGCAGCTGCTGCAGAGCAGCCAGCAGGGAGTCCCTGCCTCACTCGGAGGTCCC

Protein (1464aa)

>JHU24743
MCLLVFPLVPRSPDYILPCSPGWRLRLAASFLLSVFPLLDLLPVALPPGAGPGPIGLEVLAGCVAAVAWISHSLALWVLA
HSPHGHSRGPLALALVALLPAPALVLTVLWHCQRGTLLPPLLPGPMARLCLLILQLAALLAYALGWAAPGGPREPWAQEP
LLPEDQEPEVAEDGESWLSRFSYAWLAPLLARGACGELRQPQDICRLPHRLQPTYLARVFQAHWQEGARLWRALYGAFGR
CYLALGLLKLVGTMLGFSGPLLLSLLVGFLEEGQEPLSHGLLYALGLAGGAVLGAVLQNQYGYEVYKVTLQARGAVLNIL
YCKALQLGPSRPPTGEALNLLGTDSERLLNFAGSFHEAWGLPLQLAITLYLLYQQVGVAFVGGLILALLLVPVNKVIATR
IMASNQEMLQHKDARVKLVTELLSGIRVIKFCGWEQALGARVEACRARELGRLRVIKYLDAACVYLWAALPVVISIVIFI
TYVLMGHQLTATKVFTALALVRMLILPLNNFPWVINGLLEAKVSLDRIQLFLDLPNHNPQAYYSPDCGRLGAQIKWLLCS
DPPAEPSTVLELHGALFSWDPVGTSLETFISHLEVKKGMLVGIVGKVGCGKSSLLAAIAGELHRLRGHVAVRGLSKGFGL
ATQEPWIQFATIRDNILFGKTFDAQLYKEVLEACALNDDLSILPAGDQTEVGEKGVTLSGGQRARIALARAVYQEKELYL
LDDPLAAVDADVANHLLHRCILGMLSYTTRLLCTHRTEYLERADAVLLMEAGRLIRAGPPSEILPLVQAVPKAWAENGQE
SDSATAQSVQNPEKTKEGLEEEQSTSGRLLQEESKKEGAVALHVYQAYWKAVGQGLALAILFSLLLMQATRNAADWWLSH
WISQLKAENSSQEAQPSTSPASMGLFSPQLLLFSPGNLYIPVFPLPKAAPNGSSDIRFYLTVYATIAGVNSLCTLLRAVL
FAAGTLQAAATLHRRLLHRVLMAPVTFFNATPTGRILNRFSSDVACADDSLPFILNILLANAAGLLGLLAVLGSGLPWLL
LLLPPLSIMYYHVQRHYRASSRELRRLGSLTLSPLYSHLADTLAGLSVLRATGATYRFEEENLRLLELNQRCQFATSATM
QWLDIRLQLMGAAVVSAIAGIALVQHQQGLANPGLVGLSLSYALSLTGLLSGLVSSFTQTEAMLVSVERLEEYTCDLPQE
PQGQPLQLGTGWLTQGGVEFQDVVLAYRPGLPNALDGVTFCVQPGEKLGIVGRTGSGKSSLLLVLFRLLEPSSGRVLLDG
VDTSQLELAQLRSQLAIIPQEPFLFSGTVRENLDPQGLHKDRALWQALKQCHLSEVITSMGGLDGELGEGGRSLSLGQRQ
LLCLARALLTDAKILCIDEATASVDQKTDQLLQQTICKRFANKTVLTIAHRLNTILNSDRVLVLQAGRVVELDSPATLRN
QPHSLFQQLLQSSQQGVPASLGGP