Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU24720 NPR2 ANPRB Homo sapiens No Kinases; Membrane Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
21 61 22 JHU24720
21 62 22 JHU24720

External Database ID

Nucleotide (3141bp)

>JHU24720
ATGGCGCTGCCATCACTTCTGCTGTTGGTGGCAGCCCTGGCAGGTGGGGTGCGTCCTCCCGGGGCGCGGAACCTGACGCT
GGCGGTGGTGCTGCCAGAACACAACCTGAGCTATGCCTGGGCCTGGCCACGGGTGGGACCCGCTGTGGCACTAGCTGTGG
AGGCTCTGGGCCGGGCACTGCCCGTGGACCTGCGGTTTGTCAGCTCCGAACTGGAAGGCGCCTGCTCTGAGTACCTGGCA
CCGCTGAGCGCTGTGGACCTCAAGCTGTACCATGACCCCGACCTGCTGTTAGGTCCCGGTTGCGTGTACCCTGCTGCCTC
TGTGGCCCGCTTTGCCTCCCACTGGCGCCTTCCCCTGCTGACTGCGGGTGCTGTGGCCTCTGGTTTTTCGGCTAAGAATG
ACCATTATCGTACCCTGGTTCGCACTGGCCCCTCTGCTCCCAAGCTGGGTGAGTTTGTGGTGACACTACACGGGCACTTC
AATTGGACTGCCCGTGCTGCCTTGCTGTACCTGGATGCTCGCACAGATGACCGGCCTCACTACTTCACCATCGAGGGCGT
CTTTGAGGCCCTGCAGGGCAGCAACCTCAGTGTGCAGCACCAGGTGTATGCCCGAGAGCCAGGGGGCCCCGAGCAGGCCA
CCCACTTCATCCGGGCCAACGGGCGCATTGTGTATATCTGCGGCCCTCTGGAGATGCTGCATGAGATCCTGCTTCAGGCC
CAGAGGGAGAATCTGACCAATGGGGATTATGTCTTCTTTTACCTGGATGTCTTTGGGGAGAGTCTCCGTGCAGGCCCCAC
ACGTGCTACAGGCCGGCCCTGGCAGGACAATCGCACCCGGGAACAGGCCCAGGCCCTCAGAGAGGCCTTTCAGACTGTAT
TGGTGATCACGTACCGAGAACCCCCAAATCCTGAGTATCAGGAATTCCAGAATCGTCTGCTGATAAGAGCCCGGGAAGAC
TTTGGTGTGGAGCTGGGCCCTTCCCTGATGAACCTCATCGCTGGCTGCTTCTATGATGGGATCCTGCTATATGCTGAAGT
CCTGAATGAGACAATACAGGAAGGAGGCACCCGGGAGGATGGACTTCGAATTGTGGAAAAGATGCAGGGACGAAGATATC
ACGGTGTAACTGGGCTGGTTGTCATGGACAAGAACAATGACCGAGAGACTGACTTTGTCCTCTGGGCCATGGGAGACCTG
GATTCTGGGGACTTTCAGCCTGCAGCCCACTACTCGGGAGCTGAGAAGCAGATTTGGTGGACGGGACGGCCTATTCCCTG
GGTGAAGGGGGCTCCTCCCTCGGACAATCCCCCCTGTGCCTTTGACTTGGACGACCCATCCTGTGATAAAACTCCACTTT
CAACCCTGGCAATTGTGGCTCTGGGCACAGGAATCACCTTCATCATGTTTGGTGTTTCCAGCTTCCTAATTTTCCGAAAG
CTGATGCTGGAGAAGGAGCTGGCTAGCATGTTGTGGCGTATTCGCTGGGAAGAACTGCAGTTTGGCAACTCAGAGCGTTA
TCACAAAGGTGCAGGCAGTCGCCTCACACTGTCGCTGCGGGGATCCAGTTACGGCTCGCTCATGACAGCCCATGGGAAAT
ACCAGATCTTTGCCAACACCGGTCACTTCAAGGGAAATGTTGTCGCCATCAAACATGTGAATAAGAAGCGCATTGAGCTG
ACCCGGCAGGTTCTGTTTGAACTCAAACATATGAGAGATGTTCAGTTCAACCATCTCACTCGCTTCATTGGCGCCTGCAT
AGACCCTCCCAACATTTGCATTGTCACTGAATACTGTCCTCGTGGGAGTTTACAGGATATTCTAGAAAATGACAGCATCA
ACTTGGACTGGATGTTTCGTTATTCACTCATTAATGACCTTGTTAAGGGCATGGCCTTTCTCCACAACAGCATTATTTCA
TCGCATGGGAGTCTCAAGTCCTCCAACTGTGTGGTGGATAGTCGTTTTGTGCTCAAAATCACAGACTATGGCCTGGCCAG
CTTCCGATCAACTGCTGAACCTGATGACAGCCATGCCCTCTATGCCAAGAAGCTGTGGACTGCCCCAGAACTGCTCAGTG
GGAACCCCTTGCCAACCACAGGCATGCAGAAGGCTGACGTCTATAGCTTTGGGATCATCCTGCAGGAGATAGCACTTCGC
AGTGGTCCTTTCTACTTGGAGGGCCTGGACCTCAGCCCCAAAGAGATTGTCCAGAAGGTACGAAATGGTCAGCGGCCATA
TTTCCGGCCAAGCATTGACCGGACCCAACTGAATGAAGAGCTAGTTTTGCTGATGGAGCGATGTTGGGCTCAGGACCCAG
CTGAGCGGCCAGACTTTGGACAGATTAAGGGCTTCATTCGGCGCTTTAACAAGGAGGGTGGCACCAGCATATTGGACAAC
CTCCTGCTGCGCATGGAACAGTATGCCAATAACTTGGAGAAGCTGGTGGAGGAACGCACACAGGCCTATCTGGAGGAAAA
ACGCAAGGCTGAAGCTCTGCTCTACCAAATCCTACCCCATTCAGTGGCAGAGCAGTTAAAACGGGGAGAGACTGTACAGG
CTGAGGCCTTTGACAGTGTTACCATCTACTTCAGTGACATTGTTGGCTTCACAGCATTGTCAGCAGAGAGCACCCCCATG
CAGGTAGTGACACTTCTTAATGACCTGTATACCTGCTTTGATGCCATAATTGACAACTTTGATGTCTACAAGGTGGAGAC
GATTGGGGATGCTTACATGGTGGTATCTGGCCTCCCAGGCCGAAATGGTCAACGCCATGCACCAGAAATTGCTCGTATGG
CCCTAGCATTACTAGATGCAGTTTCTTCCTTTCGCATCCGCCACCGACCCCATGACCAGCTGAGGCTACGCATAGGGGTC
CATACTGGGCCAGTCTGTGCTGGGGTTGTTGGCCTGAAGATGCCCCGTTATTGTCTTTTTGGAGACACAGTGAACACTGC
TTCTCGAATGGAGTCTAATGGTCAAGCGCTGAAGATCCATGTCTCCTCTACCACCAAGGATGCCCTAGATGAGCTAGGAT
GCTTCCAGCTAGAGCTTCGGGGGGATGTGGAAATGAAGGGAAAAGGAAAGATGCGAACATACTGGCTCTTAGGAGAGCGG
AAAGGACCTCCTGGACTCCTG

Protein (1047aa)

>JHU24720
MALPSLLLLVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALPVDLRFVSSELEGACSEYLA
PLSAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLLTAGAVASGFSAKNDHYRTLVRTGPSAPKLGEFVVTLHGHF
NWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQA
QRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTREQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRARED
FGVELGPSLMNLIAGCFYDGILLYAEVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDL
DSGDFQPAAHYSGAEKQIWWTGRPIPWVKGAPPSDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRK
LMLEKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANTGHFKGNVVAIKHVNKKRIEL
TRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIIS
SHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALR
SGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDPAERPDFGQIKGFIRRFNKEGGTSILDN
LLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPM
QVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGV
HTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGER
KGPPGLL