Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU24707 IKZF4 KIAA1782;ZNFN1A4 Homo sapiens No Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
22 61 29 JHU24707
22 62 29 JHU24707

External Database ID

Nucleotide (1755bp)

>JHU24707
ATGCATACACCACCCGCACTCCCTCGCCGTTTCCAAGGCGGCGGCCGCGTTCGCACCCCAGGGTCTCACCGGCAAGGGAA
GGATAATCTGGAGAGGGATCCCTCAGGAGGGTGTGTTCCGGATTTCTTGCCTCAGGCCCAAGACTCCAACCATTTTATAA
TGGAATCTTTATTTTGTGAAAGTAGCGGGGACTCATCTCTGGAGAAGGAGTTCCTCGGGGCCCCAGTGGGGCCCTCGGTG
AGCACCCCCAACAGCCAGCACTCTTCTCCTAGCCGCTCACTCAGTGCCAACTCCATCAAGGTGGAGATGTACAGCGATGA
GGAGTCAAGCAGACTGCTGGGGCCAGATGAGCGGCTCCTGGAAAAGGACGACAGCGTGATTGTGGAAGATTCATTGTCTG
AGCCCCTGGGCTACTGTGATGGGAGTGGGCCAGAGCCTCACTCCCCTGGGGGCATCCGGCTGCCCAATGGCAAGCTCAAG
TGTGACGTCTGCGGCATGGTCTGTATTGGACCCAACGTGCTCATGGTGCACAAGCGCAGTCACACTGGTGAAAGGCCCTT
CCATTGCAACCAGTGTGGTGCCTCCTTCACCCAGAAGGGGAACCTGCTGCGCCACATCAAGCTGCACTCTGGGGAGAAGC
CCTTTAAATGTCCCTTCTGCAACTATGCCTGCCGCCGGCGTGATGCACTCACTGGTCACCTCCGCACACACTCAGTCTCC
TCTCCCACAGTGGGCAAGCCCTACAAGTGTAACTACTGTGGCCGGAGCTACAAACAGCAGAGTACCCTGGAGGAGCACAA
GGAGCGGTGCCATAACTACCTACAGAGTCTCAGCACTGAAGCCCAAGCTTTGGCTGGCCAACCAGGTGACGAAATACGTG
ACCTGGAGATGGTGCCAGACTCCATGCTGCACTCATCCTCTGAGCGGCCAACTTTCATCGATCGTCTGGCCAATAGCCTC
ACCAAACGCAAGCGTTCCACACCCCAGAAGTTTGTAGGCGAAAAGCAGATGCGCTTCAGCCTCTCAGACCTCCCCTATGA
TGTGAACTCGGGTGGCTATGAAAAGGATGTGGAGTTGGTGGCACACCACAGCCTAGAGCCTGGCTTTGGAAGTTCCCTGG
CCTTTGTGGGTGCAGAGCATCTGCGTCCCCTCCGCCTTCCACCCACCAATTGCATCTCAGAACTCACGCCTGTCATCAGC
TCTGTCTACACCCAGATGCAGCCCCTCCCTGGTCGACTGGAGCTTCCAGGATCCCGAGAAGCAGGTGAGGGACCTGAGGA
CCTGGCTGATGGAGGTCCCCTCCTCTACCGGCCCCGAGGCCCCCTGACTGACCCTGGGGCATCCCCCAGCAATGGCTGCC
AGGACTCCACAGACACAGAAAGCAACCACGAAGATCGGGTTGCGGGGGTGGTATCCCTCCCTCAGGGTCCCCCACCCCAG
CCACCTCCCACCATTGTGGTGGGCCGGCACAGTCCTGCCTACGCCAAAGAGGACCCCAAGCCACAGGAGGGGTTATTGCG
GGGCACCCCAGGCCCCTCCAAGGAAGTGCTTCGGGTGGTGGGCGAGAGTGGTGAGCCTGTGAAGGCCTTCAAGTGTGAGC
ACTGCCGTATCCTCTTCCTGGACCACGTCATGTTCACTATCCACATGGGCTGCCATGGCTTCAGAGACCCTTTTGAGTGC
AACATCTGTGGTTATCACAGCCAGGACCGGTACGAATTCTCTTCCCACATTGTCCGGGGGGAGCATAAGGTGGGC

Protein (585aa)

>JHU24707
MHTPPALPRRFQGGGRVRTPGSHRQGKDNLERDPSGGCVPDFLPQAQDSNHFIMESLFCESSGDSSLEKEFLGAPVGPSV
STPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSGPEPHSPGGIRLPNGKLK
CDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCNYACRRRDALTGHLRTHSVS
SPTVGKPYKCNYCGRSYKQQSTLEEHKERCHNYLQSLSTEAQALAGQPGDEIRDLEMVPDSMLHSSSERPTFIDRLANSL
TKRKRSTPQKFVGEKQMRFSLSDLPYDVNSGGYEKDVELVAHHSLEPGFGSSLAFVGAEHLRPLRLPPTNCISELTPVIS
SVYTQMQPLPGRLELPGSREAGEGPEDLADGGPLLYRPRGPLTDPGASPSNGCQDSTDTESNHEDRVAGVVSLPQGPPPQ
PPPTIVVGRHSPAYAKEDPKPQEGLLRGTPGPSKEVLRVVGESGEPVKAFKCEHCRILFLDHVMFTIHMGCHGFRDPFEC
NICGYHSQDRYEFSSHIVRGEHKVG