Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU24665 TTC39A C1orf34;KIAA0452 Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
22 61 9 JHU24665
22 62 9 JHU24665

External Database ID

Nucleotide (1734bp)

>JHU24665
ATGGGCCAGAAGGGCCACAAAGACTCCCTTTACCCTTGTGGAGGGACTCCTGAGAGCAGCCTCCATGAGGCCCTGGACCA
GTGCATGACCGCCCTGGACCTCTTCCTCACCAACCAGTTCTCAGAAGCACTCAGCTACCTCAAGCCCAGAACCAAGGAAA
GCATGTACCACTCACTGACATATGCCACCATCCTGGAGATGCAGGCCATGATGACCTTTGACCCTCAGGACATCCTGCTT
GCCGGCAACATGATGAAGGAGGCACAGATGCTGTGTCAGAGGCACCGGAGGAAGTCTTCTGTAACAGATTCCTTCAGCAG
CCTGGTGAACCGCCCCACGCTGGGCCAATTCACTGAAGAGGAAATCCACGCTGAGGTCTGCTATGCAGAGTGCCTGCTGC
AGCGAGCAGCCCTGACCTTCCTGCAGGACGAGAACATGGTGAGCTTCATCAAAGGCGGCATCAAAGTTCGAAACAGCTAC
CAGACCTACAAGGAGCTGGACAGCCTTGTTCAGTCCTCACAATACTGCAAGGGTGAGAACCACCCGCACTTTGAAGGAGG
AGTGAAGCTTGGTGTAGGGGCCTTCAACCTGACACTGTCCATGCTTCCTACTAGGATCCTGAGGCTGTTGGAGTTTGTGG
GGTTTTCAGGAAACAAGGACTATGGGCTGCTGCAGCTGGAGGAGGGAGCGTCAGGGCACAGCTTCCGCTCTGTGCTCTGT
GTCATGCTCCTGCTGTGCTACCACACCTTCCTCACCTTCGTGCTCGGTACTGGGAACGTCAACATCGAGGAGGCCGAGAA
GCTCTTGAAGCCCTACCTGAACCGGTACCCTAAGGGTGCCATCTTCCTGTTCTTTGCAGGGAGGATTGAAGTCATTAAAG
GCAACATTGATGCAGCCATCCGGCGTTTCGAGGAGTGCTGTGAGGCCCAGCAGCACTGGAAGCAGTTCCACCACATGTGC
TACTGGGAGCTGATGTGGTGCTTCACCTACAAGGGCCAGTGGAAGATGTCCTACTTCTACGCCGACCTGCTCAGCAAGGA
GAACTGCTGGTCCAAGGCCACCTACATTTACATGAAGGCCGCCTACCTCAGCATGTTTGGGAAGGAGGACCACAAGCCGT
TCGGGGACGACGAAGTGGAATTATTTCGAGCTGTGCCAGGCCTGAAGCTCAAGATTGCTGGGAAATCTCTACCCACAGAG
AAGTTTGCCATCCGGAAGTCCCGGCGCTACTTCTCCTCCAACCCTATCTCGCTGCCAGTGCCTGCTCTGGAAATGATGTA
CATCTGGAACGGCTACGCCGTGATTGGGAAGCAGCCGAAACTCACGGATGGGATACTTGAGATTATCACTAAGGCTGAAG
AGATGCTGGAGAAAGGCCCAGAGAACGAGTACTCAGTGGATGACGAGTGCTTGGTGAAATTGTTGAAAGGCCTGTGTCTG
AAATACCTGGGCCGTGTCCAGGAGGCCGAGGAGAATTTTAGGAGCATCTCTGCCAATGAAAAGAAGATTAAATATGACCA
CTACTTGATCCCAAACGCCCTGCTGGAGCTGGCCCTGCTGCTTATGGAGCAAGACAGAAACGAAGAGGCCATCAAACTTT
TGGAATCTGCCAAGCAAAACTACAAGAATTACTCCATGGAGTCAAGGACACACTTTCGAATCCAGGCAGCCACACTCCAA
GCCAAGTCTTCCCTAGAGAACAGCAGCAGATCCATGGTCTCATCAGTGTCCTTG

Protein (578aa)

>JHU24665
MGQKGHKDSLYPCGGTPESSLHEALDQCMTALDLFLTNQFSEALSYLKPRTKESMYHSLTYATILEMQAMMTFDPQDILL
AGNMMKEAQMLCQRHRRKSSVTDSFSSLVNRPTLGQFTEEEIHAEVCYAECLLQRAALTFLQDENMVSFIKGGIKVRNSY
QTYKELDSLVQSSQYCKGENHPHFEGGVKLGVGAFNLTLSMLPTRILRLLEFVGFSGNKDYGLLQLEEGASGHSFRSVLC
VMLLLCYHTFLTFVLGTGNVNIEEAEKLLKPYLNRYPKGAIFLFFAGRIEVIKGNIDAAIRRFEECCEAQQHWKQFHHMC
YWELMWCFTYKGQWKMSYFYADLLSKENCWSKATYIYMKAAYLSMFGKEDHKPFGDDEVELFRAVPGLKLKIAGKSLPTE
KFAIRKSRRYFSSNPISLPVPALEMMYIWNGYAVIGKQPKLTDGILEIITKAEEMLEKGPENEYSVDDECLVKLLKGLCL
KYLGRVQEAEENFRSISANEKKIKYDHYLIPNALLELALLLMEQDRNEEAIKLLESAKQNYKNYSMESRTHFRIQAATLQ
AKSSLENSSRSMVSSVSL