Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU24632 MGAT5B KIAA2008 Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone

External Database ID

Nucleotide (2403bp)

>JHU24632
ATGCACTCATTCGTAAAACATTTGTGCAGCCGGTACGTGGTGGAGCGTCAGGGCACGATGGCCCTTCCTGCCCTCCTGAC
CCGCCTCCTTCCTCTCCGCAGGCTTTTTGTCCTGGGCATCGGCTTCTTCACTCTCTGCTTCCTGATGACGTCTCTGGGAG
GCCAGTTCTCGGCCCGGCGCCTGGGGGACTCGCCATTCACCATCCGCACAGAAGTGATGGGGGGCCCCGAGTCCCGCGGC
GTCCTGCGCAAGATGAGCGACCTGCTGGAGCTGATGGTGAAGCGCATGGACGCACTGGCCAGGCTGGAGAACAGCAGTGA
GCTGCACCGGGCCGGCGGCGACCTGCACTTTCCCGCAGACAGGATGCCCCCTGGGGCCGGCCTCATGGAGCGGATCCAGG
CTATTGCCCAGAACGTCTCCGACATCGCTGTGAAGGTGGACCAGATCCTGCGCCACAGTCTGCTCCTGCACAGCAAGGTG
TCAGAAGGCCGGCGGGACCAGTGTGAGGCACCCAGTGACCCCAAGTTCCCTGACTGCTCAGGGAAGGTGGAGTGGATGCG
TGCCCGCTGGACCTCTGACCCCTGCTACGCCTTCTTTGGGGTGGACGGCACCGAGTGCTCCTTCCTCATCTACCTCAGTG
AGGTCGAGTGGTTCTGCCCCCCGCTGCCCTGGAGGAACCAGACGGCTGCCCAGAGGGCACCCAAGCCCCTCCCCAAAGTC
CAGGCAGTTTTCCGAAGCAACCTGTCCCACCTTCTGGACCTGATGGGCAGCGGGAAGGAGTCCCTGATCTTCATGAAGAA
GCGGACCAAGAGGCTCACAGCCCAGTGGGCGCTGGCTGCCCAGCGCCTGGCACAGAAGCTGGGGGCCACCCAGAGGGACC
AGAAGCAGATCCTGGTCCACATCGGCTTCCTGACGGAGGAGTCCGGGGACGTGTTCAGCCCTCGGGTCCTGAAGGGCGGG
CCCCTAGGGGAGATGGTGCAGTGGGCGGACATTCTGACTGCACTCTATGTCCTGGGCCATGGCCTGCGGGTCACAGTCTC
CCTGAAGGAGCTGCAGAGTAACTTAGGGGTACCGCCAGGCCGGGGAAGCTGCCCGCTCACCATGCCCCTGCCCTTCGACC
TCATCTACACCGACTACCACGGCCTGCAGCAGATGAAGCGGCACATGGGACTCTCCTTCAAGAAGTACCGGTGCCGAATC
AGGGTCATCGACACCTTCGGGACGGAACCTGCGTACAACCACGAGGAGTACGCCACGCTGCACGGCTACCGGACCAACTG
GGGCTACTGGAACCTCAACCCCAAGCAGTTCATGACCATGTTTCCTCATACCCCCGACAACTCCTTCATGGGCTTCGTGT
CCGAGGAGCTCAACGAGACGGAGAAGCGGCTCATCAAAGGCGGCAAGGCCAGCAACATGGCCGTGGTGTACGGCAAGGAG
GCGAGCATCTGGAAGGGGAAGGAGAAGTTCCTGGGCATCCTGAACAAATACATGGAGATCCATGGCACCGTGTACTACGA
GAGCCAGCGGCCCCCCGAGGTGCCAGCCTTTGTGAAGAACCACGGCCTCTTACCGCAGCCTGAGTTTCAGCAGCTGCTGC
GCAAGGCCAAACTCTTCATCGGGTTTGGCTTCCCCTACGAGGGCCCCGCCCCCCTGGAGGCCATCGCCAATGGTTGCATC
TTCCTGCAGTCCCGCTTCAGCCCGCCCCACAGCTCCCTCAACCACGAGTTCTTCCGAGGCAAGCCCACCTCCAGAGAGGT
GTTCTCCCAGCATCCCTACGCGGAGAACTTCATCGGCAAGCCCCACGTGTGGACAGTCGACTACAACAACTCAGAGGAGT
TTGAAGCAGCCATCAAGGCCATTATGAGAACTCAGGTAGACCCCTACCTACCCTACGAGTACACCTGCGAGGGGATGCTG
GAGCGGATCCACGCCTACATCCAGCACCAGGACTTCTGCAGAGCTCCAGACCCTGCCCTACCAGAGGCCCACGCCCCGCA
GAGCCCCTTTGTCCTGGCCCCCAATGCCACCCACCTCGAGTGGGCTCGGAACACCAGCTTGGCTCCTGGGGCCTGGCCCC
CCGCGCACGCCCTGCGGGCCTGGCTGGCCGTGCCTGGGAGGGCCTGCACCGACACCTGCCTGGACCACGGGCTAATCTGT
GAGCCCTCCTTCTTCCCCTTCCTGAACAGCCAGGACGCCTTCCTCAAGCTGCAGGTGCCCTGTGACAGCACCGAGTCGGA
GATGAACCACCTGTACCCGGCGTTCGCCCAGCCTGGCCAGGAGTGCTACCTGCAGAAGGAGCCTCTGCTCTTCAGCTGCG
CCGGCTCCAACACCAAGTACCGCCGGCTCTGCCCCTGCCGCGACTTCCGCAAGGGCCAGGTGGCCTTGTGCCAGGGCTGT
CTG

Protein (801aa)

>JHU24632
MHSFVKHLCSRYVVERQGTMALPALLTRLLPLRRLFVLGIGFFTLCFLMTSLGGQFSARRLGDSPFTIRTEVMGGPESRG
VLRKMSDLLELMVKRMDALARLENSSELHRAGGDLHFPADRMPPGAGLMERIQAIAQNVSDIAVKVDQILRHSLLLHSKV
SEGRRDQCEAPSDPKFPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIYLSEVEWFCPPLPWRNQTAAQRAPKPLPKV
QAVFRSNLSHLLDLMGSGKESLIFMKKRTKRLTAQWALAAQRLAQKLGATQRDQKQILVHIGFLTEESGDVFSPRVLKGG
PLGEMVQWADILTALYVLGHGLRVTVSLKELQSNLGVPPGRGSCPLTMPLPFDLIYTDYHGLQQMKRHMGLSFKKYRCRI
RVIDTFGTEPAYNHEEYATLHGYRTNWGYWNLNPKQFMTMFPHTPDNSFMGFVSEELNETEKRLIKGGKASNMAVVYGKE
ASIWKGKEKFLGILNKYMEIHGTVYYESQRPPEVPAFVKNHGLLPQPEFQQLLRKAKLFIGFGFPYEGPAPLEAIANGCI
FLQSRFSPPHSSLNHEFFRGKPTSREVFSQHPYAENFIGKPHVWTVDYNNSEEFEAAIKAIMRTQVDPYLPYEYTCEGML
ERIHAYIQHQDFCRAPDPALPEAHAPQSPFVLAPNATHLEWARNTSLAPGAWPPAHALRAWLAVPGRACTDTCLDHGLIC
EPSFFPFLNSQDAFLKLQVPCDSTESEMNHLYPAFAQPGQECYLQKEPLLFSCAGSNTKYRRLCPCRDFRKGQVALCQGC
L