Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU24614 DMBX1 MBX;OTX3;PAXB Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone

External Database ID

Nucleotide (1146bp)

>JHU24614
ATGCAGCACTACGGGGTGAACGGCTACTCACTGCACGCCATGAACTCACTCAGCGCCATGTACAACCTGCACCAGCAGGC
AGCCCAGCAGGCCCAGCATGCCCCCGACTACCGGCCTTCAGTGCATGCGCTTACATTGGCTGAGCGCCTGGCTGGCTGTA
CATTTCAAGACATCATCTTGGAGGCCCGTTATGGTTCCCAGCACCGCAAACAACGTCGCAGCCGCACAGCGTTCACGGCT
CAGCAGCTCGAGGCCCTGGAAAAGACCTTCCAGAAGACTCACTACCCAGATGTGGTGATGCGTGAGAGGCTGGCCATGTG
CACCAACCTGCCTGAGGCCCGGGTGCAGGTGTGGTTCAAGAACCGCCGGGCCAAGTTCCGGAAGAAGCAGCGTAGCCTGC
AGAAGGAACAGCTCCAGAAGCAGAAGGAGGCTGAGGGCTCCCATGGGGAAGGCAAGGCCGAGGCCCCCACTCCAGATACC
CAGCTGGACACTGAGCAGCCCCCACGTCTGCCTGGCAGCGACCCCCCTGCTGAGCTTCACCTGAGTCTGTCTGAGCAGTC
AGCCAGTGAGTCAGCCCCCGAGGATCAGCCGGACCGTGAGGAGGACCCCAGGGCAGGGGCTGAGGACCCCAAAGCTGAGA
AGAGCCCTGGGGCTGACAGCAAGGGGCTGGGCTGCAAGAGGGGCAGCCCCAAGGCAGATTCCCCAGGCAGCCTGACCATC
ACTCCTGTGGCCCCAGGGGGTGGCCTCCTGGGCCCCTCCCACTCCTATTCCTCGTCCCCGCTGAGCCTCTTCCGTCTGCA
GGAGCAATTCCGCCAGCACATGGCGGCCACCAACAACCTGGTGCACTACTCGTCCTTCGAAGTAGGGGGTCCGGCCCCTG
CTGCTGCAGCGGCGGCTGCTGCTGTGCCCTACCTGGGCGTCAACATGGCCCCGCTGGGCTCACTGCACTGCCAGTCCTAC
TACCAGTCCCTGTCAGCAGCCGCTGCTGCCCACCAGGGTGTGTGGGGGTCTCCTCTGCTGCCTGCACCCCCAGCAGGCCT
GGCTCCTGCATCAGCTACCCTGAACAGTAAAACCACAAGCATCGAGAACCTGCGGCTCCGGGCCAAGCAGCACGCGGCCT
CCCTGGGACTCGATACGCTGCCCAAC

Protein (382aa)

>JHU24614
MQHYGVNGYSLHAMNSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLAGCTFQDIILEARYGSQHRKQRRSRTAFTA
QQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQKEQLQKQKEAEGSHGEGKAEAPTPDT
QLDTEQPPRLPGSDPPAELHLSLSEQSASESAPEDQPDREEDPRAGAEDPKAEKSPGADSKGLGCKRGSPKADSPGSLTI
TPVAPGGGLLGPSHSYSSSPLSLFRLQEQFRQHMAATNNLVHYSSFEVGGPAPAAAAAAAAVPYLGVNMAPLGSLHCQSY
YQSLSAAAAAHQGVWGSPLLPAPPAGLAPASATLNSKTTSIENLRLRAKQHAASLGLDTLPN