Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00316 FN3KRP Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
13 1 1 JHU00316
13 1 2 JHU00316
HuProt v3.0
Block Row Column Clone
4 1 13 JHU00316
4 2 13 JHU00316
HuProt v3.1
Block Row Column Clone
4 1 13 JHU00316
4 2 13 JHU00316

External Database ID

Nucleotide (930bp)

>JHU00316
ATGGAGGAGCTGCTGAGGCGCGAGCTGGGCTGCAGCTCTGTCAGGGCCACGGGCCACTCGGGGGGCGGGTGCATCAGCCA
GGGCCGGAGCTACGACACGGATCAAGGACGAGTGTTCGTGAAAGTGAACCCCAAGGCGGAGGCCAGAAGAATGTTTGAAG
GTGAGATGGCAAGTTTAACTGCCATCCTGAAAACAAACACGGTGAAAGTGCCCAAGCCCATCAAGGTTCTGGATGCCCCA
GGCGGCGGGAGCGTGCTGGTGATGGAGCACATGGACATGAGGCATCTGAGCAGTCATGCTGCAAAGCTTGGAGCCCAGCT
GGCCGATTTACACCTTGATAACAAGAAGCTTGGAGAGATGCGCCTGAAGGAGGCGGGCACAGTGGGGAGAGGAGGTGGGC
AGGAGGAACGGCCCTTTGTGGCCCGGTTTGGATTTGACGTGGTGACGTGCTGTGGATACCTCCCCCAGGTGAATGACTGG
CAGGAGGACTGGGTCGTGTTCTATGCCCGGCAGCGCATTCAGCCCCAGATGGACATGGTGGAGAAGGAGTCTGGGGACAG
GGAGGCCCTCCAGCTTTGGTCTGCTCTGCAGTTAAAGATCCCTGACCTGTTCCGTGACCTGGAGATCATCCCAGCCTTAC
TCCACGGGGACCTCTGGGGTGGAAACGTAGCAGAGGATTCCTCTGGGCCGGTGATTTTTGACCCAGCTTCTTTCTACGGC
CACTCGGAATATGAGCTGGCAATAGCTGGCATGTTTGGGGGCTTTAGCAGCTCCTTTTACTCCGCCTACCACGGCAAAAT
CCCCAAGGCCCCAGGATTCGAGAAGCGCCTTCAGTTGTATCAGCTCTTTCACTACTTGAACCACTGGAATCATTTTGGAT
CGGGGTACAGAGGATCCTCCCTGAACATCATGAGGAATCTGGTCAAGTAG

Protein (309aa)

>JHU00316
MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARRMFEGEMASLTAILKTNTVKVPKPIKVLDAP
GGGSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFVARFGFDVVTCCGYLPQVNDW
QEDWVVFYARQRIQPQMDMVEKESGDREALQLWSALQLKIPDLFRDLEIIPALLHGDLWGGNVAEDSSGPVIFDPASFYG
HSEYELAIAGMFGGFSSSFYSAYHGKIPKAPGFEKRLQLYQLFHYLNHWNHFGSGYRGSSLNIMRNLVK