Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU24520 TSHZ1 SDCCAG33;TSH1 Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone

External Database ID

Nucleotide (3096bp)

>JHU24520
ATGTGCAATGAAGAGACGGAGATCAAAGAGGCGCAGAGCTACCAGAACTCCCCAGTCAGCTCTGCGACTAACCAGGACGC
CGGCTACGGGTCGCCCTTCAGTGAGAGCAGCGACCAGCTAGCCCATTTCAAAGGCTCTTCCTCTCGAGAAGAGAAGGAGG
ATCCGCAGTGTCCCGACAGCGTCTCGTACCCCCAGGACAGCCTGGCACAGATCAAAGCTGTGTATGCAAACTTGTTCTCC
GAGTCCTGCTGGTCCAGCTTAGCTCTGGATTTAAAGAAGTCGGGTTCCACCACCAGCACCAACGATGCCAGCCAGAAGGA
GAGCTCCGCCCCCACCCCCACACCCCCCACCTGCCCCGTCAGCACCACTGGCCCCACCACGAGCACGCCCAGCACCAGCT
GCAGCTCCAGCACCAGCCACAGCAGTACCACCAGTACCAGCAGCAGCTCCGGGTACGACTGGCACCAGGCTGCACTGGCC
AAGACGCTGCAGCAGACGTCCTCGTATGGGCTGCTTCCTGAGCCCAGCCTGTTCAGCACCGTGCAGCTCTACCGCCAGAA
CAACAAGCTCTACGGCTCCGTCTTCACGGGCGCCAGCAAGTTCCGGTGCAAAGACTGCAGTGCCGCGTACGACACGCTGG
TGGAACTGACGGTGCACATGAACGAGACAGGCCACTACCGTGACGACAACAGGGACAAGGACTCCGAGAAGACCAAGAGG
TGGTCCAAGCCCAGGAAGCGCTCCCTGATGGAGATGGAGGGGAAGGAGGATGCCCAGAAGGTGCTGAAGTGCATGTACTG
TGGACACTCCTTTGAGTCCTTGCAGGACCTCAGCGTCCACATGATCAAAACCAAGCATTACCAGAAAGTGCCTCTGAAGG
AGCCAGTGCCAGCCATCACCAAACTGGTCCCCTCCACCAAAAAGCGGGCGCTTCAGGACCTGGCGCCCCCCTGCTCCCCT
GAGCCAGCAGGAATGGCCGCAGAGGTGGCCCTGAGTGAGTCAGCCAAGGATCAGAAAGCAGCGAACCCGTACGTCACGCC
CAATAACCGCTATGGCTACCAGAATGGCGCCAGCTACACCTGGCAGTTTGAGGCCCGCAAGGCGCAGATCCTCAAGTGCA
TGGAGTGTGGCAGCTCCCACGACACGCTGCAGCAGCTCACCGCCCACATGATGGTCACCGGGCACTTCCTGAAAGTGACC
ACCTCGGCTTCTAAGAAGGGCAAGCAGTTGGTGCTGGACCCTGTGGTGGAAGAGAAGATCCAGTCCATCCCACTACCGCC
CACCACCCACACGCGGCTGCCGGCCTCCAGCATCAAAAAGCAGCCCGACTCTCCCGCGGGGTCCACGACTTCTGAAGAAA
AGAAAGAGCCAGAGAAGGAGAAGCCGCCTGTGGCTGGCGACGCGGAGAAGATCAAGGAGGAGAGTGAGGACAGCTTGGAG
AAATTTGAGCCCAGCACCCTGTACCCGTACCTGCGTGAGGAGGACCTGGACGACAGCCCCAAGGGAGGGCTGGACATTCT
CAAGTCCCTGGAGAATACCGTCTCCACGGCCATTAGCAAAGCTCAGAATGGTGCGCCCTCATGGGGTGGCTACCCCAGCA
TCCATGCAGCCTACCAGCTCCCGGGCACCGTGAAGCCACTGCCGGCGGCCGTGCAGAGCGTGCAGGTGCAGCCGTCCTAT
GCTGGCGGCGTGAAGTCGCTGTCTTCCGCCGAGCACAACGCCCTCCTGCACTCCCCAGGGAGCCTCACGCCCCCACCGCA
CAAGAGCAACGTGTCTGCCATGGAGGAGCTGGTGGAGAAGGTCACGGGCAAGGTCAACATCAAGAAGGAGGAGAGACCCC
CTGAGAAGGAGAAGAGCTCCCTGGCCAAGGCTGCGTCCCCCATAGCAAAAGAGAATAAAGATTTCCCGAAAACGGAGGAA
GTCAGCGGCAAACCACAGAAGAAGGGCCCTGAGGCCGAGACTGGGAAGGCCAAAAAGGAGGGACCGCTGGACGTTCACAC
CCCAAATGGCACAGAGCCTCTCAAAGCAAAGGTCACCAACGGCTGTAACAACCTGGGGATCATCATGGACCACTCACCGG
AGCCTTCCTTCATCAACCCGCTGAGCGCTTTGCAGTCCATCATGAACACCCACCTGGGCAAGGTGTCCAAGCCCGTGAGT
CCCTCGCTGGACCCGCTGGCGATGCTGTACAAGATCAGCAACAGCATGCTGGACAAGCCGGTGTACCCCGCCACCCCTGT
GAAGCAGGCCGATGCCATCGACCGCTACTATTATGAAAACAGCGACCAGCCCATTGACTTAACCAAGTCCAAGAACAAGC
CGCTGGTGTCCAGCGTGGCTGATTCGGTGGCATCACCTCTGCGGGAGAGCGCACTCATGGACATCTCCGACATGGTGAAA
AACCTCACAGGCCGCCTGACGCCCAAGTCCTCCACGCCCTCCACAGTTTCAGAGAAGTCCGATGCTGATGGCAGCAGCTT
TGAGGAGGCGTTGGACGAGCTGTCACCGGTCCACAAGAGGAAGGGCCGGCAGTCCAACTGGAACCCGCAGCACCTTCTCA
TCCTGCAGGCCCAGTTCGCCTCGAGCTTGCGGGAGACCACAGAGGGCAAGTACATCATGTCGGACTTGGGCCCGCAGGAG
AGGGTGCACATCTCGAAGTTTACTGGGCTCTCCATGACCACCATCAGCCACTGGCTGGCCAATGTGAAGTACCAGTTGAG
GAGGACAGGGGGAACGAAATTCCTAAAGAACCTGGACACAGGGCATCCTGTTTTCTTTTGCAACGATTGTGCCTCTCAGT
TCAGAACTGCTTCTACATACATAAGTCATTTGGAGACACACTTGGGCTTCAGCCTGAAGGATCTCTCCAAGCTGCCACTC
AATCAGATTCAAGAACAGCAGAATGTTTCGAAAGTCCTCACCAACAAAACTCTGGGCCCACTGGGGGCCACCGAGGAAGA
CTTGGGCTCCACATTCCAATGTAAGCTCTGCAACCGGACTTTTGCGAGCAAGCACGCAGTCAAACTGCACCTTAGTAAGA
CCCACGGCAAGTCTCCCGAGGACCACCTGATCTATGTGACTGAGTTGGAGAAACAG

Protein (1032aa)

>JHU24520
MCNEETEIKEAQSYQNSPVSSATNQDAGYGSPFSESSDQLAHFKGSSSREEKEDPQCPDSVSYPQDSLAQIKAVYANLFS
ESCWSSLALDLKKSGSTTSTNDASQKESSAPTPTPPTCPVSTTGPTTSTPSTSCSSSTSHSSTTSTSSSSGYDWHQAALA
KTLQQTSSYGLLPEPSLFSTVQLYRQNNKLYGSVFTGASKFRCKDCSAAYDTLVELTVHMNETGHYRDDNRDKDSEKTKR
WSKPRKRSLMEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKVPLKEPVPAITKLVPSTKKRALQDLAPPCSP
EPAGMAAEVALSESAKDQKAANPYVTPNNRYGYQNGASYTWQFEARKAQILKCMECGSSHDTLQQLTAHMMVTGHFLKVT
TSASKKGKQLVLDPVVEEKIQSIPLPPTTHTRLPASSIKKQPDSPAGSTTSEEKKEPEKEKPPVAGDAEKIKEESEDSLE
KFEPSTLYPYLREEDLDDSPKGGLDILKSLENTVSTAISKAQNGAPSWGGYPSIHAAYQLPGTVKPLPAAVQSVQVQPSY
AGGVKSLSSAEHNALLHSPGSLTPPPHKSNVSAMEELVEKVTGKVNIKKEERPPEKEKSSLAKAASPIAKENKDFPKTEE
VSGKPQKKGPEAETGKAKKEGPLDVHTPNGTEPLKAKVTNGCNNLGIIMDHSPEPSFINPLSALQSIMNTHLGKVSKPVS
PSLDPLAMLYKISNSMLDKPVYPATPVKQADAIDRYYYENSDQPIDLTKSKNKPLVSSVADSVASPLRESALMDISDMVK
NLTGRLTPKSSTPSTVSEKSDADGSSFEEALDELSPVHKRKGRQSNWNPQHLLILQAQFASSLRETTEGKYIMSDLGPQE
RVHISKFTGLSMTTISHWLANVKYQLRRTGGTKFLKNLDTGHPVFFCNDCASQFRTASTYISHLETHLGFSLKDLSKLPL
NQIQEQQNVSKVLTNKTLGPLGATEEDLGSTFQCKLCNRTFASKHAVKLHLSKTHGKSPEDHLIYVTELEKQ