Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU24477 DEFB110 DEFB10;DEFB11;DEFB111 Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone

External Database ID

Nucleotide (201bp)

>JHU24477
ATGAAGATTCAACTTTTTTTCTTTATTCTGCACTTTTGGGTCACAATTTTACCAGCCAAAAAGAAATATCCTGAGTATGG
TAGCTTGGACTTGAGGAGAGAGTGCAGAATAGGTAATGGTCAATGTAAAAATCAGTGTCATGAAAATGAAATTAGGATTG
CTTACTGCATAAGACCTGGAACTCATTGCTGCTTGCAGCAG

Protein (67aa)

>JHU24477
MKIQLFFFILHFWVTILPAKKKYPEYGSLDLRRECRIGNGQCKNQCHENEIRIAYCIRPGTHCCLQQ