Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00314 FGF12 FGF12B;FHF1 Homo sapiens Yes Nuclear Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
21 1 1 JHU00314
21 1 2 JHU00314
HuProt v3.0
Block Row Column Clone
4 1 21 JHU00314
4 2 21 JHU00314
HuProt v3.1
Block Row Column Clone
4 1 21 JHU00314
4 2 21 JHU00314

External Database ID

Nucleotide (546bp)

>JHU00314
ATGGAGAGCAAAGAACCCCAGCTAAAAGGGATTGTGACAAGGTTATTCAGCCAGCAGGGATACTTCCTGCAGATGCACCC
AGATGGTACCATTGATGGGACCAAGGACGAAAACAGCGACTACACTCTCTTCAATCTAATTCCCGTGGGCCTGCGTGTAG
TGGCCATCCAAGGAGTGAAGGCTAGCCTCTATGTGGCCATGAATGGTGAAGGCTATCTCTACAGTTCAGATGTTTTCACT
CCAGAATGCAAATTCAAGGAATCTGTGTTTGAAAACTACTATGTGATCTATTCTTCCACACTGTACCGCCAGCAAGAATC
AGGCCGAGCTTGGTTTCTGGGACTCAATAAAGAAGGTCAAATTATGAAGGGGAACAGAGTGAAGAAAACCAAGCCCTCAT
CACATTTTGTACCGAAACCTATTGAAGTGTGTATGTACAGAGAACAATCGCTACATGAAATTGGAGAAAAACAAGGGCGT
TCAAGGAAAAGTTCTGGAACACCAACCATGAATGGAGGCAAAGTTGTGAATCAAGATTCAACATAG

Protein (181aa)

>JHU00314
MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFT
PECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGR
SRKSSGTPTMNGGKVVNQDST