Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU24457 POU4F1 BRN3A;RDC1 Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone

External Database ID

Nucleotide (1257bp)

>JHU24457
ATGATGTCCATGAACAGCAAGCAGCCTCACTTTGCCATGCATCCCACCCTCCCTGAGCACAAGTACCCGTCGCTGCACTC
CAGCTCCGAGGCCATCCGGCGGGCCTGCCTGCCCACGCCGCCGCTGCAGAGCAACCTCTTCGCCAGCCTGGACGAGACGC
TGCTGGCGCGGGCCGAGGCGCTGGCGGCCGTGGACATCGCCGTGTCCCAGGGCAAGAGCCATCCTTTCAAGCCGGACGCC
ACGTACCACACGATGAACAGCGTGCCGTGCACGTCCACTTCCACGGTGCCTCTGGCGCACCACCACCACCACCACCACCA
CCACCAGGCGCTCGAACCCGGCGATCTGCTGGACCACATCTCCTCGCCGTCGCTCGCGCTCATGGCCGGCGCGGGCGGCG
CGGGCGCGGCGGCCGGCGGCGGCGGCGCCCACGACGGCCCGGGGGGCGGTGGCGGCCCGGGCGGCGGCGGCGGCCCGGGC
GGCGGCCCCGGGGGAGGCGGCGGTGGCGGCCCGGGGGGCGGCGGCGGCGGCCCGGGCGGCGGGCTCCTGGGCGGCTCCGC
GCACCCTCACCCGCATATGCACAGCCTGGGCCACCTGTCGCACCCCGCGGCGGCGGCCGCCATGAACATGCCGTCCGGGC
TGCCGCACCCCGGGCTGGTGGCGGCGGCGGCGCACCACGGCGCGGCAGCGGCAGCGGCGGCGGCGGCGGCCGGGCAGGTG
GCAGCGGCATCGGCGGCGGCGGCCGTGGTGGGCGCAGCGGGCCTGGCGTCCATCTGCGACTCGGACACGGACCCGCGCGA
GCTCGAGGCGTTCGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGCGTGACGCAGGCCGACGTGGGCTCGGCGCTGG
CCAACCTCAAGATCCCGGGCGTGGGCTCACTCAGCCAGAGCACCATCTGCAGGTTCGAGTCGCTCACGCTCTCGCACAAC
AACATGATCGCGCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGGCGCCCAGCGCGAGAAAATGAACAAGCC
TGAGCTCTTCAACGGCGGCGAGAAGAAGCGCAAGCGGACTTCCATCGCCGCGCCCGAGAAGCGCTCCCTCGAGGCCTACT
TCGCCGTGCAGCCCCGGCCCTCGTCCGAGAAGATCGCCGCCATCGCCGAGAAACTGGACCTCAAAAAGAACGTGGTGCGG
GTGTGGTTTTGCAACCAGAGACAGAAGCAGAAGCGGATGAAATTCTCTGCCACTTAC

Protein (419aa)

>JHU24457
MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQGKSHPFKPDA
TYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPG
GGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLSHPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAGQV
AAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHN
NMIALKPILQAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVR
VWFCNQRQKQKRMKFSATY