Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU24406 PLA2G4D Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone

External Database ID

Nucleotide (2454bp)

>JHU24406
ATGGAGAGCCTGTCACCTGGGGGACCACCTGGCCACCCTTACCAGGGGGAGGCCTCTACCTGCTGGCAGCTCACAGTGAG
GGTCCTGGAGGCGCGGAACCTGCGCTGGGCTGACCTGTTGAGTGAGGCCGACCCTTACGTGATCCTACAGCTGTCGACCG
CACCTGGAATGAAGTTTAAGACCAAGACGCTCACCGACACCAGTCATCCTGTGTGGAATGAGGCCTTCCGTTTCCTTATC
CAAAGTCAGGTCAAGAATGTTCTGGAGCTTAGCATCTATGATGAGGACTCAGTCACGGAGGATGACATCTGCTTCAAGGT
TCTCTATGACATCTCAGAAGTCCTCCCTGGCAAGCTGCTCCGGAAAACCTTCTCCCAGAGTCCCCAGGGAGAGGAGGAGC
TGGATGTGGAGTTCCTGATGGAAGAAACGTCAGATCGCCCAGAAAACCTCATCACCAACAAAGTCATTGTGGCCCGAGAG
CTGTCATGCCTGGATGTGCATCTGGACAGCACAGGGAGCACCGCTGTGGTTGCAGATCAGGACAAGCTGGAGCTGGAGCT
GGTGCTGAAGGGGTCCTATGAGGACACACAGACATCCTTCCTGGGCACAGCCTCTGCCTTCCGCTTCCACTACATGGCAG
CCCTAGAGACAGAGCTGAGCGGGCGCCTGAGGAGCTCCAGAAGCAATGGCTGGAATGGGGACAACTCAGCTGGGTACCTC
ACTGTGCCCCTGAGGCCCTTGACCATTGGGAAGGAGGTGACTATGGATGTTCCTGCTCCAAATGCCCCAGGAGTGAGGCT
GCAGCTCAAGGCAGAGGGCTGCCCTGAGGAGCTGGCCGTGCACCTGGGCTTCAATCTCTGTGCAGAGGAGCAGGCCTTCC
TGAGCAGGAGGAAGCAGGTGGTGGCCAAGGCCCTGAAGCAGGCCCTGCAGCTGGACAGAGACCTGCAGGAGGATGAGGTA
CCCGTTGTGGGCATCATGGCCACAGGAGGAGGTGCCCGGGCCATGACCTCACTCTACGGCCACCTATTGGCCTTGCAGAA
GCTGGGCCTCCTAGACTGTGTGACCTACTTCAGTGGCATCTCTGGCTCTACGTGGACAATGGCCCACCTGTACGGGGACC
CTGAGTGGTCGCAGAGGGACCTGGAGGGACCTATCAGATACGCCCGGGAGCACCTGGCCAAGAGCAAGCTGGAGGTCTTT
TCCCCAGAGCGCCTGGCGAGCTACCGCCGGGAGCTGGAGCTGCGGGCTGAGCAGGGCCACCCCACGACCTTTGTGGACCT
GTGGGCGCTAGTGCTGGAGTCCATGCTGCACGGCCAGGTGATGGATCAGAAGCTGTCAGGACAGAGAGCCGCCCTGGAAC
GGGGTCAGAACCCTCTGCCCCTCTACTTGAGCCTCAATGTCAAAGAGAACAATCTGGAGACACTGGACTTCAAGGAGTGG
GTTGAGTTCTCCCCCTATGAGGTCGGTTTCCTGAAGTACGGGGCCTTCGTCCCTCCTGAGCTCTTCGGCTCCGAGTTCTT
CATGGGACGGCTGATGAGGAGGATCCCGGAGCCCCGGATCTGCTTTCTGGAAGCCATCTGGAGCAACATTTTCTCCCTGA
ACCTGCTGGATGCCTGGTATGACCTCACCAGTTCTGGGGAGTCCTGGAAACAGCACATCAAGGACAAGACCAGGAGCTTA
GAGAAGGAGCCCCTGACCACCTCGGGGACCTCCTCGCGGCTGGAGGCCTCGTGGCTGCAGCCAGGCACGGCGCTGGCCCA
GGCATTTAAAGGCTTCCTGACAGGCAGGCCCCTCCACCAGCGCAGCCCCAACTTCCTCCAGGGCCTCCAGCTGCACCAGG
ACTACTGTAGCCACAAAGACTTCTCCACCTGGGCAGACTACCAGCTTGACTCCATGCCCAGCCAGCTGACCCCCAAGGAG
CCCCGGCTCTGCCTGGTGGACGCCGCCTACTTCATCAACACCAGCTCTCCCTCCATGTTCCGGCCAGGCCGCAGGCTGGA
CCTCATCCTCTCCTTCGACTACTCCCTATCTGCGCCCTTCGAGGCACTGCAGCAGACGGAGCTGTACTGCCGGGCCCGGG
GGCTGCCCTTCCCCCGGGTGGAACCCAGCCCTCAGGACCAGCACCAGCCAAGGGAATGCCACCTCTTCTCAGACCCCGCC
TGCCCCGAGGCCCCGATCCTGCTGCACTTCCCGCTGGTCAATGCCTCCTTCAAGGACCACTCAGCCCCCGGTGTCCAGCG
CAGCCCCGCAGAGCTCCAGGGTGGCCAAGTGGATCTCACCGGGGCCACCTGCCCCTACACCCTGTCCAACATGACCTACA
AGGAGGAAGACTTCGAGCGCCTGCTGCGGCTCAGTGACTACAACGTGCAGACCAGCCAGGGTGCCATCCTGCAGGCCCTG
AGGACCGCGCTGAAGCACCGGACTCTAGAGGCGAGGCCTCCAAGGGCACAGACC

Protein (818aa)

>JHU24406
MESLSPGGPPGHPYQGEASTCWQLTVRVLEARNLRWADLLSEADPYVILQLSTAPGMKFKTKTLTDTSHPVWNEAFRFLI
QSQVKNVLELSIYDEDSVTEDDICFKVLYDISEVLPGKLLRKTFSQSPQGEEELDVEFLMEETSDRPENLITNKVIVARE
LSCLDVHLDSTGSTAVVADQDKLELELVLKGSYEDTQTSFLGTASAFRFHYMAALETELSGRLRSSRSNGWNGDNSAGYL
TVPLRPLTIGKEVTMDVPAPNAPGVRLQLKAEGCPEELAVHLGFNLCAEEQAFLSRRKQVVAKALKQALQLDRDLQEDEV
PVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGISGSTWTMAHLYGDPEWSQRDLEGPIRYAREHLAKSKLEVF
SPERLASYRRELELRAEQGHPTTFVDLWALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEW
VEFSPYEVGFLKYGAFVPPELFGSEFFMGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWYDLTSSGESWKQHIKDKTRSL
EKEPLTTSGTSSRLEASWLQPGTALAQAFKGFLTGRPLHQRSPNFLQGLQLHQDYCSHKDFSTWADYQLDSMPSQLTPKE
PRLCLVDAAYFINTSSPSMFRPGRRLDLILSFDYSLSAPFEALQQTELYCRARGLPFPRVEPSPQDQHQPRECHLFSDPA
CPEAPILLHFPLVNASFKDHSAPGVQRSPAELQGGQVDLTGATCPYTLSNMTYKEEDFERLLRLSDYNVQTSQGAILQAL
RTALKHRTLEARPPRAQT