Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00309 CNOT2 CDC36;NOT2 Homo sapiens Yes Cell Death; Kinases; Nuclear Proteins

HuProt v2.0
Block Row Column Clone
37 1 7 JHU00309
37 1 8 JHU00309
HuProt v3.0
Block Row Column Clone
3 5 21 JHU00309
3 6 21 JHU00309
HuProt v3.1
Block Row Column Clone
3 5 21 JHU00309
3 6 21 JHU00309

External Database ID

Nucleotide (1623bp)

>JHU00309
ATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGGTGACAAACAGCATGTTTGGTGCTTCAAGAAA
GAAGTTTGTAGAGGGGGTCGACAGTGACTACCATGACGAAAACATGTACTACAGCCAGTCTTCTATGTTTCCACATCGGT
CAGAAAAAGATATGCTGGCATCACCATCTACATCAGGTCAGCTGTCTCAGTTTGGGGCAAGTTTATACGGGCAACAAAGT
GCACTAGGCCTTCCAATGAGGGGGATGAGCAACAATACCCCTCAGTTAAATCGCAGCTTATCACAAGGCACTCAGTTACC
GAGCCACGTCACGCCAACAACAGGGGTACCAACAATGTCACTTCACACGCCTCCATCTCCAAGCAGGGGTATTTTGCCTA
TGAATCCTAGGAATATGATGAACCACTCCCAGGTTGGTCAGGGCATTGGAATTCCTAGCAGGACAAATAGCATGAGCAGT
TCAGGGTTAGGTAGCCCCAACAGAAGCTCGCCAAGCATAATATGTATGCCAAAGCAGCAGCCTTCTCGACAGCCTTTTAC
TGTGAACAGTATGTCTGGATTTGGAATGAACAGGAATCAGGCATTTGGAATGAATAACTCCTTATCAAGTAACATTTTTA
ATGGAACAGACGGAAGTGAAAATGTGACAGGATTGGACCTTTCAGATTTCCCAGCATTAGCAGACCGAAACAGGAGGGAA
GGAAGTGGTAACCCAACTCCATTAATAAACCCCTTGGCTGGAAGAGCTCCTTATGTTGGAATGGTAACAAAACCAGCAAA
TGAACAATCCCAGGACTTCTCAATACACAATGAAGATTTTCCAGCATTACCAGGCTCCAGCTATAAAGATCCAACATCAA
GTAATGATGACAGTAAATCTAATTTGAATACATCTGGCAAGACAACTTCAAGTACAGATGGACCCAAATTCCCTGGAGAT
AAAAGTTCAACAACACAAAATAATAACCAGCAGAAAAAAGGGATCCAGGTGTTACCTGATGGTCGGGTTACTAACATTCC
TCAAGGGATGGTGACGGACCAATTTGGAATGATTGGCCTGTTAACATTTATCAGGGCAGCAGAGACAGACCCAGGAATGG
TACATCTTGCATTAGGAAGTGACTTAACAACATTAGGCCTCAATCTGAACTCTCCTGAAAATCTCTACCCCAAATTTGCG
TCACCCTGGGCATCTTCACCTTGTCGACCTCAAGACATAGACTTCCATGTTCCATCTGAGTACTTAACGAACATTCACAT
TAGGGATAAGCTGGCTGCAATAAAACTTGGCCGATATGGTGAAGACCTTCTCTTCTATCTCTATTACATGAATGGAGGAG
ACGTATTACAACTTTTAGCTGCAGTGGAGCTTTTTAACCGTGATTGGAGATACCACAAAGAAGAACGAGTATGGATTACC
AGGGCACCAGGCATGGAGCCAACAATGAAAACCAATACCTATGAGAGGGGAACATATTACTTCTTTGACTGTCTTAACTG
GAGGAAAGTAGCTAAGGAGTTCCATCTGGAATATGACAAATTAGAAGAACGGCCTCACCTGCCATCCACCTTCAACTACA
ACCCTGCTCAGCAAGCCTTCTAG

Protein (540aa)

>JHU00309
MVRTDGHTLSEKRNYQVTNSMFGASRKKFVEGVDSDYHDENMYYSQSSMFPHRSEKDMLASPSTSGQLSQFGASLYGQQS
ALGLPMRGMSNNTPQLNRSLSQGTQLPSHVTPTTGVPTMSLHTPPSPSRGILPMNPRNMMNHSQVGQGIGIPSRTNSMSS
SGLGSPNRSSPSIICMPKQQPSRQPFTVNSMSGFGMNRNQAFGMNNSLSSNIFNGTDGSENVTGLDLSDFPALADRNRRE
GSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGD
KSSTTQNNNQQKKGIQVLPDGRVTNIPQGMVTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFA
SPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWIT
RAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF