Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00301 CA12 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
21 1 5 JHU00301
21 1 6 JHU00301
HuProt v3.0
Block Row Column Clone
3 1 21 JHU00301
3 2 21 JHU00301
HuProt v3.1
Block Row Column Clone
3 1 21 JHU00301
3 2 21 JHU00301
24 43 7 JHU00301
24 44 7 JHU00301

External Database ID

Nucleotide (1065bp)

>JHU00301
ATGCCCCGGCGCAGCCTGCACGCGGCGGCCGTGCTCCTGCTGGTGATCTTAAAGGAACAGCCTTCCAGCCCGGCCCCAGT
GAACGGTTCCAAGTGGACTTATTTTGGTCCTGATGGGGAGAATAGCTGGTCCAAGAAGTACCCGTCGTGTGGGGGCCTGC
TGCAGTCCCCCATAGACCTGCACAGTGACATCCTCCAGTATGACGCCAGCCTCACGCCCCTCGAGTTCCAAGGCTACAAT
CTGTCTGCCAACAAGCAGTTTCTCCTGACCAACAATGGCCATTCAGTGAAGCTGAACCTGCCCTCGGACATGCACATCCA
GGGCCTCCAGTCTCGCTACAGTGCCACGCAGCTGCACCTGCACTGGGGGAACCCGAATGACCCGCACGGCTCTGAGCACA
CCGTCAGCGGACAGCACTTCGCCGCCGAGCTGCACATTGTCCATTATAACTCAGACCTTTATCCTGACGCCAGCACTGCC
AGCAACAAGTCAGAAGGCCTCGCTGTCCTGGCTGTTCTCATTGAGATGGGCTCCTTCAATCCGTCCTATGACAAGATCTT
CAGTCACCTTCAACATGTAAAGTACAAAGGCCAGGAAGCATTCGTCCCGGGATTCAACATTGAAGAGCTGCTTCCGGAGA
GGACCGCTGAATATTACCGCTACCGGGGGTCCCTGACCACACCCCCTTGCAACCCCACTGTGCTCTGGACAGTTTTCCGA
AACCCCGTGCAAATTTCCCAGGAGCAGCTGCTGGCTTTGGAGACAGCCCTGTACTGCACACACATGGACGACCCTTCCCC
CAGAGAAATGATCAACAACTTCCGGCAGGTCCAGAAGTTCGATGAGAGGCTGGTATACACCTCCTTCTCCCAAGTGCAAG
TCTGTACTGCGGCAGGACTGAGTCTGGGCATCATCCTCTCACTGGCCCTGGCTGGCATTCTTGGCATCTGTATTGTGGTG
GTGGTGTCCATTTGGCTTTTCAGAAGGAAGAGTATCAAAAAAGGTGATAACAAGGGAGTCATTTACAAGCCAGCCACCAA
GATGGAGACTGAGGCCCACGCTTAG

Protein (354aa)

>JHU00301
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYN
LSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTA
SNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVV
VVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA